SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|215483143|ref|YP_002325350.1| from Acinetobacter baumannii AB307-0294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|215483143|ref|YP_002325350.1|
Domain Number 1 Region: 14-139
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 3.53e-38
Family Molybdopterin synthase subunit MoaE 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|215483143|ref|YP_002325350.1|
Sequence length 161
Comment molybdopterin-converting factor subunit 2 [Acinetobacter baumannii AB307-0294]
Sequence
MRDFARIQEQALSLDIFDSIESFPECGGVDIFMGTVRNHHEGKAVKALKYTSYKPLSEKM
IREIELEIEKKYQVSYVRVVHRIGYLDVGETAIIAIAYAAHRREAFQACEEAVERVKHEV
PVFKEEFFTDGTSHYVEGCCIRKDAPHDHKHHHHTGHEHSH
Download sequence
Identical sequences A0A0D5YGM9 A0A0J1AA18 B0V721
480119.AB57_2346 509173.ABAYE1551 557600.ABBFA_001447 gi|169795657|ref|YP_001713450.1| gi|213158398|ref|YP_002319696.1| gi|215483143|ref|YP_002325350.1| WP_001204147.1.100152 WP_001204147.1.101338 WP_001204147.1.101409 WP_001204147.1.13480 WP_001204147.1.13635 WP_001204147.1.13850 WP_001204147.1.16288 WP_001204147.1.16701 WP_001204147.1.16787 WP_001204147.1.16850 WP_001204147.1.17002 WP_001204147.1.1753 WP_001204147.1.1863 WP_001204147.1.20066 WP_001204147.1.24292 WP_001204147.1.2475 WP_001204147.1.26921 WP_001204147.1.28236 WP_001204147.1.28581 WP_001204147.1.29461 WP_001204147.1.29779 WP_001204147.1.29927 WP_001204147.1.30597 WP_001204147.1.31121 WP_001204147.1.32223 WP_001204147.1.3225 WP_001204147.1.32532 WP_001204147.1.33308 WP_001204147.1.34917 WP_001204147.1.36122 WP_001204147.1.37386 WP_001204147.1.3836 WP_001204147.1.39159 WP_001204147.1.39901 WP_001204147.1.41878 WP_001204147.1.43766 WP_001204147.1.44058 WP_001204147.1.44964 WP_001204147.1.46080 WP_001204147.1.46887 WP_001204147.1.47219 WP_001204147.1.47436 WP_001204147.1.49463 WP_001204147.1.50111 WP_001204147.1.50216 WP_001204147.1.51314 WP_001204147.1.51378 WP_001204147.1.51709 WP_001204147.1.52310 WP_001204147.1.52342 WP_001204147.1.54138 WP_001204147.1.54464 WP_001204147.1.54492 WP_001204147.1.54885 WP_001204147.1.55447 WP_001204147.1.58802 WP_001204147.1.59456 WP_001204147.1.60484 WP_001204147.1.60678 WP_001204147.1.61759 WP_001204147.1.6221 WP_001204147.1.62800 WP_001204147.1.62817 WP_001204147.1.6289 WP_001204147.1.63224 WP_001204147.1.63649 WP_001204147.1.63906 WP_001204147.1.64044 WP_001204147.1.64586 WP_001204147.1.64646 WP_001204147.1.65154 WP_001204147.1.66771 WP_001204147.1.67003 WP_001204147.1.67823 WP_001204147.1.68705 WP_001204147.1.69859 WP_001204147.1.70461 WP_001204147.1.70993 WP_001204147.1.71347 WP_001204147.1.7172 WP_001204147.1.73056 WP_001204147.1.74318 WP_001204147.1.74949 WP_001204147.1.75478 WP_001204147.1.75620 WP_001204147.1.75896 WP_001204147.1.7651 WP_001204147.1.76571 WP_001204147.1.77396 WP_001204147.1.78984 WP_001204147.1.79254 WP_001204147.1.79789 WP_001204147.1.8108 WP_001204147.1.82036 WP_001204147.1.82355 WP_001204147.1.82967 WP_001204147.1.83297 WP_001204147.1.84099 WP_001204147.1.85449 WP_001204147.1.85683 WP_001204147.1.87319 WP_001204147.1.88040 WP_001204147.1.89643 WP_001204147.1.91832 WP_001204147.1.92611 WP_001204147.1.93437 WP_001204147.1.93485 WP_001204147.1.94012 WP_001204147.1.94129 WP_001204147.1.95001 WP_001204147.1.97300 WP_001204147.1.99770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]