SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217958068|ref|YP_002336612.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217958068|ref|YP_002336612.1|
Domain Number 1 Region: 4-428
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.04e-124
Family GABA-aminotransferase-like 0.00000000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217958068|ref|YP_002336612.1|
Sequence length 434
Comment glutamate-1-semialdehyde aminotransferase [Bacillus cereus AH187]
Sequence
MVVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGKGAYFWDVDGNKYIDY
LAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSG
TEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQE
VITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVI
YDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQA
GTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGILEQAEKHNIDITLNRLKGAL
TVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGINLAPSKYEAWFLTTEHTKEDIEYTI
EAVGRAFAALANNK
Download sequence
Identical sequences A0A151URT3 A0A229M3N6 A0A243IBY9 A0A243NVT2 A0A2K1RU17 B7HU66 B9J3N2 C2MFT6 C2RYQ5
gi|222094266|ref|YP_002528323.1| WP_000260535.1.100684 WP_000260535.1.10069 WP_000260535.1.100873 WP_000260535.1.101309 WP_000260535.1.101550 WP_000260535.1.10762 WP_000260535.1.11044 WP_000260535.1.11060 WP_000260535.1.12751 WP_000260535.1.13024 WP_000260535.1.16199 WP_000260535.1.17408 WP_000260535.1.17899 WP_000260535.1.1850 WP_000260535.1.18840 WP_000260535.1.19173 WP_000260535.1.20687 WP_000260535.1.20865 WP_000260535.1.23100 WP_000260535.1.23110 WP_000260535.1.23200 WP_000260535.1.24184 WP_000260535.1.24377 WP_000260535.1.24709 WP_000260535.1.25757 WP_000260535.1.26499 WP_000260535.1.27334 WP_000260535.1.29209 WP_000260535.1.31685 WP_000260535.1.32522 WP_000260535.1.33045 WP_000260535.1.33061 WP_000260535.1.3318 WP_000260535.1.3615 WP_000260535.1.37093 WP_000260535.1.37990 WP_000260535.1.38425 WP_000260535.1.41976 WP_000260535.1.42165 WP_000260535.1.43533 WP_000260535.1.43762 WP_000260535.1.44463 WP_000260535.1.46244 WP_000260535.1.46746 WP_000260535.1.47097 WP_000260535.1.48010 WP_000260535.1.48164 WP_000260535.1.48311 WP_000260535.1.48599 WP_000260535.1.49056 WP_000260535.1.49428 WP_000260535.1.50316 WP_000260535.1.50514 WP_000260535.1.51087 WP_000260535.1.52756 WP_000260535.1.54775 WP_000260535.1.54782 WP_000260535.1.55057 WP_000260535.1.56055 WP_000260535.1.57203 WP_000260535.1.57565 WP_000260535.1.57815 WP_000260535.1.57859 WP_000260535.1.58037 WP_000260535.1.58814 WP_000260535.1.59052 WP_000260535.1.59773 WP_000260535.1.60274 WP_000260535.1.61944 WP_000260535.1.64377 WP_000260535.1.64706 WP_000260535.1.65983 WP_000260535.1.70645 WP_000260535.1.71648 WP_000260535.1.72514 WP_000260535.1.77370 WP_000260535.1.77576 WP_000260535.1.77690 WP_000260535.1.77902 WP_000260535.1.79250 WP_000260535.1.79658 WP_000260535.1.79687 WP_000260535.1.80239 WP_000260535.1.80571 WP_000260535.1.80955 WP_000260535.1.81088 WP_000260535.1.82533 WP_000260535.1.82986 WP_000260535.1.84337 WP_000260535.1.8450 WP_000260535.1.86082 WP_000260535.1.87627 WP_000260535.1.8923 WP_000260535.1.90671 WP_000260535.1.91080 WP_000260535.1.91404 WP_000260535.1.93932 WP_000260535.1.95457 WP_000260535.1.95484 WP_000260535.1.96356 WP_000260535.1.97617 WP_000260535.1.99266 gi|217958068|ref|YP_002336612.1| 361100.BCQ_0559 405534.BCAH187_A0587 gi|375282604|ref|YP_005103041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]