SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217958729|ref|YP_002337277.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217958729|ref|YP_002337277.1|
Domain Number 1 Region: 3-395
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.15e-126
Family GABA-aminotransferase-like 0.00000000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217958729|ref|YP_002337277.1|
Sequence length 396
Comment ornithine--oxo-acid transaminase [Bacillus cereus AH187]
Sequence
MIQTKDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPK
IINALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTNKEMVLPMNTGAEAVETAIKTARRW
AYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIVVIPYGDLEALK
AAITPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFA
CDWDGVTPDMYILGKALGGGVFPISCVAANRDILGVFEPGSHGSTFGGNPLACAVSIAAL
EVLEEEKLTERSLQLGEKLVGQLKEIDNPMITEVRGKGLFIGIELNEPARPYCEQLKAAG
LLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVLS
Download sequence
Identical sequences A0A0E1MKL7 A0A0F5RNM0 A0A0P0PME0 A0A0T8VPT7 A0A1J9YPW5 A0A1J9YW64 A0A229MTJ3 A0A243BVI6 A0A243HU86 A0A243IKG8 A0A243NQY8 A0A246UHK1 A0A2A8YQK9 A0A2B4F8C7 A0A2K1RY81 B7HZS5 B9ITF9 C2MHH3 C2QPQ1 C2S0E5 C3BZ07 J8D343 J8IR45 Q63EL1 Q73C12
222523.BCE_1256 288681.BCZK1050 361100.BCQ_1211 405534.BCAH187_A1307 gi|217958729|ref|YP_002337277.1| gi|375283221|ref|YP_005103659.1| WP_000616655.1.100684 WP_000616655.1.10069 WP_000616655.1.100873 WP_000616655.1.101309 WP_000616655.1.101550 WP_000616655.1.101843 WP_000616655.1.10762 WP_000616655.1.11044 WP_000616655.1.11060 WP_000616655.1.1228 WP_000616655.1.13024 WP_000616655.1.13299 WP_000616655.1.16199 WP_000616655.1.17408 WP_000616655.1.17899 WP_000616655.1.17927 WP_000616655.1.1850 WP_000616655.1.18840 WP_000616655.1.19173 WP_000616655.1.20665 WP_000616655.1.20687 WP_000616655.1.20865 WP_000616655.1.20973 WP_000616655.1.21643 WP_000616655.1.226 WP_000616655.1.23100 WP_000616655.1.23110 WP_000616655.1.23200 WP_000616655.1.24182 WP_000616655.1.24184 WP_000616655.1.24377 WP_000616655.1.24709 WP_000616655.1.24759 WP_000616655.1.2521 WP_000616655.1.25757 WP_000616655.1.26499 WP_000616655.1.27334 WP_000616655.1.28913 WP_000616655.1.29209 WP_000616655.1.29451 WP_000616655.1.3026 WP_000616655.1.30336 WP_000616655.1.31503 WP_000616655.1.31685 WP_000616655.1.32522 WP_000616655.1.33045 WP_000616655.1.33061 WP_000616655.1.3318 WP_000616655.1.34158 WP_000616655.1.35255 WP_000616655.1.35518 WP_000616655.1.3561 WP_000616655.1.3612 WP_000616655.1.3615 WP_000616655.1.37093 WP_000616655.1.37626 WP_000616655.1.37990 WP_000616655.1.38425 WP_000616655.1.39001 WP_000616655.1.40839 WP_000616655.1.41976 WP_000616655.1.42165 WP_000616655.1.43533 WP_000616655.1.43762 WP_000616655.1.44463 WP_000616655.1.45089 WP_000616655.1.45385 WP_000616655.1.46244 WP_000616655.1.46746 WP_000616655.1.46864 WP_000616655.1.47097 WP_000616655.1.47441 WP_000616655.1.47936 WP_000616655.1.48010 WP_000616655.1.48164 WP_000616655.1.48311 WP_000616655.1.48599 WP_000616655.1.49056 WP_000616655.1.49428 WP_000616655.1.49802 WP_000616655.1.50316 WP_000616655.1.50514 WP_000616655.1.50770 WP_000616655.1.51087 WP_000616655.1.51335 WP_000616655.1.51656 WP_000616655.1.52494 WP_000616655.1.52756 WP_000616655.1.53621 WP_000616655.1.54775 WP_000616655.1.54782 WP_000616655.1.55057 WP_000616655.1.56055 WP_000616655.1.5628 WP_000616655.1.57203 WP_000616655.1.57245 WP_000616655.1.57565 WP_000616655.1.57815 WP_000616655.1.57859 WP_000616655.1.58037 WP_000616655.1.58328 WP_000616655.1.58814 WP_000616655.1.59052 WP_000616655.1.59773 WP_000616655.1.60274 WP_000616655.1.61944 WP_000616655.1.62107 WP_000616655.1.6340 WP_000616655.1.64377 WP_000616655.1.64706 WP_000616655.1.65758 WP_000616655.1.65983 WP_000616655.1.66331 WP_000616655.1.6753 WP_000616655.1.69970 WP_000616655.1.70645 WP_000616655.1.71441 WP_000616655.1.71648 WP_000616655.1.71953 WP_000616655.1.72514 WP_000616655.1.7398 WP_000616655.1.74337 WP_000616655.1.7628 WP_000616655.1.77370 WP_000616655.1.77576 WP_000616655.1.77690 WP_000616655.1.77902 WP_000616655.1.79043 WP_000616655.1.79252 WP_000616655.1.79658 WP_000616655.1.79687 WP_000616655.1.80239 WP_000616655.1.80571 WP_000616655.1.80955 WP_000616655.1.81088 WP_000616655.1.82421 WP_000616655.1.82533 WP_000616655.1.82986 WP_000616655.1.83070 WP_000616655.1.84337 WP_000616655.1.84422 WP_000616655.1.8450 WP_000616655.1.86082 WP_000616655.1.87627 WP_000616655.1.8923 WP_000616655.1.89675 WP_000616655.1.90671 WP_000616655.1.91080 WP_000616655.1.91404 WP_000616655.1.92347 WP_000616655.1.93932 WP_000616655.1.94373 WP_000616655.1.95457 WP_000616655.1.95484 WP_000616655.1.95786 WP_000616655.1.96356 WP_000616655.1.97617 WP_000616655.1.98519 WP_000616655.1.98557 WP_000616655.1.99266 gi|42780330|ref|NP_977577.1| gi|222094873|ref|YP_002528933.1| gi|402553365|ref|YP_006594636.1| gi|52144178|ref|YP_082651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]