SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217958901|ref|YP_002337449.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217958901|ref|YP_002337449.1|
Domain Number 1 Region: 4-360
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.24e-82
Family Cystathionine synthase-like 0.0000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217958901|ref|YP_002337449.1|
Sequence length 365
Comment 2-aminoethylphosphonate--pyruvate transaminase [Bacillus cereus AH187]
Sequence
MTENHYLLLTPGPLTTTKTVKEVMLYDWCTWDVEYNMMVQQVRAKLVSLATKEEERYITV
LMQGSGTFSVEAVIGSVIPKNGKMLVCTNGAYGKRIVQMAEMLHIDVVVSQTEEWEPTNI
VEVEKILQQDKEITHIAVVHCETTTGIINPIVDVCKLGKQYGKVTLVDAMSSFGGIEIDI
AELQIDFLISSANKCIQGVPGFGFVIAKRDELLKCKGQARSLSLDLYDKWETMENQNGKW
RFTSPTHVVHAFYQALLELEKEGGVKARYNRYDNNQKLLVNRMREIGFKPLVDEKYQSPI
ITSFIYPEEWFDFEQLYNELKRDGFVIYPGKISKVDTFRIGNIGDVHEADIHRLVDSIAK
GVVIG
Download sequence
Identical sequences A0A1Y6ADX6 B7HK48 C2S0W5
gi|375283395|ref|YP_005103833.1| WP_000138243.1.13299 WP_000138243.1.18840 WP_000138243.1.24377 WP_000138243.1.27334 WP_000138243.1.32522 WP_000138243.1.33061 WP_000138243.1.43762 WP_000138243.1.46746 WP_000138243.1.47097 WP_000138243.1.48164 WP_000138243.1.48311 WP_000138243.1.48599 WP_000138243.1.51087 WP_000138243.1.52756 WP_000138243.1.55057 WP_000138243.1.77576 WP_000138243.1.79658 WP_000138243.1.82986 WP_000138243.1.8923 WP_000138243.1.91404 WP_000138243.1.99266 405534.BCAH187_A1481 gi|217958901|ref|YP_002337449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]