SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217959126|ref|YP_002337674.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217959126|ref|YP_002337674.1|
Domain Number 1 Region: 1-390
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.85e-120
Family AAT-like 0.000000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217959126|ref|YP_002337674.1|
Sequence length 395
Comment aspartate aminotransferase [Bacillus cereus AH187]
Sequence
MKLAKRVAALTPSATLEITAKAQALKAEGHDVIGLGAGEPDFNTPEHIMDAAHKAMLEGH
TKYTPTGGLQALKQEIVKKFTRDQGIAYDPSEIIVCNGAKHALYTLFQVLLDEGDEVIIP
TPYWVSYPEQVKLAGGKPVYVEGLEDNEYKITAKQLREAITEKTKAVIINSPSNPTGMIY
SKEELQQLGEVCLEHNILIVSDEIYEKLIYGGAEYTSVAQLSNALKEQTLIINGVSKSHS
MTGWRIGYAAGNKQLIKAMTNLASHSTSNPTSIAQYGAIAAYAGSQEPVETMRQAFEERL
NIIYDKLIQIPGFTCIKPQGAFYLFPNVKEAVALSGYETVDDWAKALLEEEKVALVPGTG
FGAPNNVRLSYATSLEQVEKALERIHTFMKSKVQA
Download sequence
Identical sequences A0A0F5RU07 A0A0T8X580 A0A1J9Z7D3 A0A1T2P3H7 A0A229M6E2 A0A243HU33 A0A2C3H2X9 A0A2C9ZG60 A0A2K1S1L5 B7HL59 B9IVR7 C2MIK9 C2S1J0 F0PWN1 J8D771 J8JAU2
gi|217959126|ref|YP_002337674.1| gi|375283624|ref|YP_005104062.1| 361100.BCQ_1614 405534.BCAH187_A1712 WP_000761548.1.100241 WP_000761548.1.100684 WP_000761548.1.10069 WP_000761548.1.100873 WP_000761548.1.101309 WP_000761548.1.101843 WP_000761548.1.10762 WP_000761548.1.12751 WP_000761548.1.13024 WP_000761548.1.13299 WP_000761548.1.16199 WP_000761548.1.17408 WP_000761548.1.17899 WP_000761548.1.17927 WP_000761548.1.18840 WP_000761548.1.20687 WP_000761548.1.20865 WP_000761548.1.21172 WP_000761548.1.21643 WP_000761548.1.23100 WP_000761548.1.24184 WP_000761548.1.24377 WP_000761548.1.24709 WP_000761548.1.26499 WP_000761548.1.27334 WP_000761548.1.29209 WP_000761548.1.31685 WP_000761548.1.32522 WP_000761548.1.33045 WP_000761548.1.33061 WP_000761548.1.3318 WP_000761548.1.35255 WP_000761548.1.3615 WP_000761548.1.37093 WP_000761548.1.37990 WP_000761548.1.38425 WP_000761548.1.41976 WP_000761548.1.43533 WP_000761548.1.43762 WP_000761548.1.44463 WP_000761548.1.46244 WP_000761548.1.46746 WP_000761548.1.46864 WP_000761548.1.47097 WP_000761548.1.47441 WP_000761548.1.48010 WP_000761548.1.48164 WP_000761548.1.48311 WP_000761548.1.48599 WP_000761548.1.49056 WP_000761548.1.49428 WP_000761548.1.50316 WP_000761548.1.50514 WP_000761548.1.51087 WP_000761548.1.52756 WP_000761548.1.54775 WP_000761548.1.54782 WP_000761548.1.55057 WP_000761548.1.56055 WP_000761548.1.5628 WP_000761548.1.57203 WP_000761548.1.57245 WP_000761548.1.57565 WP_000761548.1.57815 WP_000761548.1.57859 WP_000761548.1.58037 WP_000761548.1.58328 WP_000761548.1.58814 WP_000761548.1.59773 WP_000761548.1.60274 WP_000761548.1.61231 WP_000761548.1.64377 WP_000761548.1.6753 WP_000761548.1.69970 WP_000761548.1.70645 WP_000761548.1.72514 WP_000761548.1.77576 WP_000761548.1.77690 WP_000761548.1.79250 WP_000761548.1.79252 WP_000761548.1.79658 WP_000761548.1.80955 WP_000761548.1.80964 WP_000761548.1.81088 WP_000761548.1.82421 WP_000761548.1.82533 WP_000761548.1.82986 WP_000761548.1.83070 WP_000761548.1.84337 WP_000761548.1.8450 WP_000761548.1.87627 WP_000761548.1.8923 WP_000761548.1.89675 WP_000761548.1.91080 WP_000761548.1.91404 WP_000761548.1.91569 WP_000761548.1.91615 WP_000761548.1.93932 WP_000761548.1.95457 WP_000761548.1.95484 WP_000761548.1.95786 WP_000761548.1.99266 gi|222095274|ref|YP_002529334.1| gi|384179577|ref|YP_005565339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]