SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217959803|ref|YP_002338355.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217959803|ref|YP_002338355.1|
Domain Number 1 Region: 9-427
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.55e-116
Family GABA-aminotransferase-like 0.000004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217959803|ref|YP_002338355.1|
Sequence length 436
Comment hypothetical protein BCAH187_A2402 [Bacillus cereus AH187]
Sequence
MRDYLIKPLVGQPYPMISHGKGVYLYDQNGNKYFDGSSGAITAGIGHGVKEIADVIKKQA
EEIAFVYRSQFTSEPAEKLAKKLSDLSVGDLNWSFFVNSGTEANETAMKIAIQHFQERGI
QGKHKILSRWMSYHGITMGALSMSGHPLRRQRFVSILEDYPTIPAPYCFRCPVQKVYPTC
QLACATELERSIERIGAEHIAAFIAEPIIGAAGGAVVPPKEYYKVIKDICSHYDILFIAD
EVMTGLGRTGAWFAMEHWGVEPDIMTLGKGLGAGYTPMAATVVSDRVMEPILRGSRSVMS
GHTLSANPLSAATALAVIEYMEKHNLPEKTAEKGEYLIKGLQKVQQQSTIIADVRGKGLL
IGVELQPFTKASELISVAAKNGLLLYQAVSGQAGKEDSALLVAPPMTTTYSELDELLSIF
AKSVEEMMQKGGHSIA
Download sequence
Identical sequences A0A0E1MC26 A0A0F5RV60 A0A0P0PQ73 A0A0T8XEJ5 A0A1J9SS60 A0A1J9Y0T5 A0A1J9YGT9 A0A229MU21 A0A242YGL8 A0A243IBA1 A0A243ISV2 A0A243NI35 A0A2A8LDA4 A0A2B4EX28 A0A2K1RPU9 B7HQ86 B9IZU4 F0PNB9 J8JIB3 Q738R6
gi|384180240|ref|YP_005566002.1| gi|222095888|ref|YP_002529945.1| gi|217959803|ref|YP_002338355.1| gi|375284317|ref|YP_005104755.1| gi|402557481|ref|YP_006598752.1| WP_001205894.1.100241 WP_001205894.1.100684 WP_001205894.1.10069 WP_001205894.1.100873 WP_001205894.1.101550 WP_001205894.1.10762 WP_001205894.1.11060 WP_001205894.1.12751 WP_001205894.1.13024 WP_001205894.1.13299 WP_001205894.1.16199 WP_001205894.1.17408 WP_001205894.1.17899 WP_001205894.1.17927 WP_001205894.1.1850 WP_001205894.1.18840 WP_001205894.1.19173 WP_001205894.1.20687 WP_001205894.1.20973 WP_001205894.1.21172 WP_001205894.1.21643 WP_001205894.1.226 WP_001205894.1.23100 WP_001205894.1.23110 WP_001205894.1.23200 WP_001205894.1.24184 WP_001205894.1.24377 WP_001205894.1.24709 WP_001205894.1.24759 WP_001205894.1.2521 WP_001205894.1.25757 WP_001205894.1.26499 WP_001205894.1.27334 WP_001205894.1.28913 WP_001205894.1.29209 WP_001205894.1.3026 WP_001205894.1.30317 WP_001205894.1.31503 WP_001205894.1.31685 WP_001205894.1.32522 WP_001205894.1.33045 WP_001205894.1.33061 WP_001205894.1.3318 WP_001205894.1.35255 WP_001205894.1.3612 WP_001205894.1.3615 WP_001205894.1.37093 WP_001205894.1.37990 WP_001205894.1.38517 WP_001205894.1.39001 WP_001205894.1.40839 WP_001205894.1.42165 WP_001205894.1.43533 WP_001205894.1.43762 WP_001205894.1.44463 WP_001205894.1.45089 WP_001205894.1.46746 WP_001205894.1.46864 WP_001205894.1.47097 WP_001205894.1.47441 WP_001205894.1.48164 WP_001205894.1.48311 WP_001205894.1.48599 WP_001205894.1.49056 WP_001205894.1.49428 WP_001205894.1.49802 WP_001205894.1.50316 WP_001205894.1.50514 WP_001205894.1.50770 WP_001205894.1.51087 WP_001205894.1.51335 WP_001205894.1.51656 WP_001205894.1.52494 WP_001205894.1.52756 WP_001205894.1.53621 WP_001205894.1.54775 WP_001205894.1.54782 WP_001205894.1.55057 WP_001205894.1.56055 WP_001205894.1.57203 WP_001205894.1.57245 WP_001205894.1.57565 WP_001205894.1.57815 WP_001205894.1.57859 WP_001205894.1.58037 WP_001205894.1.58328 WP_001205894.1.58814 WP_001205894.1.59052 WP_001205894.1.59773 WP_001205894.1.60274 WP_001205894.1.61231 WP_001205894.1.61944 WP_001205894.1.62107 WP_001205894.1.6340 WP_001205894.1.64377 WP_001205894.1.64706 WP_001205894.1.65983 WP_001205894.1.66932 WP_001205894.1.67108 WP_001205894.1.6753 WP_001205894.1.69970 WP_001205894.1.70645 WP_001205894.1.71441 WP_001205894.1.71648 WP_001205894.1.72514 WP_001205894.1.7398 WP_001205894.1.7628 WP_001205894.1.77370 WP_001205894.1.77576 WP_001205894.1.77690 WP_001205894.1.77902 WP_001205894.1.79043 WP_001205894.1.79250 WP_001205894.1.79252 WP_001205894.1.79658 WP_001205894.1.80239 WP_001205894.1.80571 WP_001205894.1.80964 WP_001205894.1.81088 WP_001205894.1.82421 WP_001205894.1.82533 WP_001205894.1.82986 WP_001205894.1.84337 WP_001205894.1.84422 WP_001205894.1.8450 WP_001205894.1.86082 WP_001205894.1.87627 WP_001205894.1.88431 WP_001205894.1.8923 WP_001205894.1.89675 WP_001205894.1.90671 WP_001205894.1.91080 WP_001205894.1.91404 WP_001205894.1.91569 WP_001205894.1.91615 WP_001205894.1.92347 WP_001205894.1.93932 WP_001205894.1.95457 WP_001205894.1.95484 WP_001205894.1.95786 WP_001205894.1.96356 WP_001205894.1.97617 WP_001205894.1.98519 WP_001205894.1.98557 WP_001205894.1.98571 WP_001205894.1.99266 222523.BCE_2328 361100.BCQ_2228 405534.BCAH187_A2402 gi|42781391|ref|NP_978638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]