SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217960198|ref|YP_002338758.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217960198|ref|YP_002338758.1|
Domain Number 1 Region: 10-414
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.32e-73
Family Cystathionine synthase-like 0.00000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217960198|ref|YP_002338758.1|
Sequence length 428
Comment kynureninase [Bacillus cereus AH187]
Sequence
MYKEPFQPTYEYALECDKHDELKDFQTEFYKKEGTIYLDGNSLGLLSKRAEKSLLTLLDS
WKEYGIDGWTEGEHPWFFLSEKLGELTAPLIGALPEETIVTGSTTTNIHQVIATFYEPKG
IRTKILADELTFPSDIYALQSQIRLKGLDPDEHLVRVKSRDGRTLSEDDIIHAMTDDIAL
ILLPSVLYRSGQVLDMKRLTAEAHKRGIHIGFDLCHSIGSIPHHFKEWDVDFAVWCNYKY
LNAGPGGVGGLYINNKHFNRLPGLSGWFSSRKDKQFDMEHTLTAADHAGAYQIGTPHVLS
TAPLIGSLEIFKDAGIERLREKSLHITSYMLNLIAHELSDFEFTIGNPLEDEKRGGHIYL
EHAEAARICKALKANGVIPDFRAPNGVRLAPVALYNTYEEVWKSVQILKKIMKDEEYKQF
ENKREVVA
Download sequence
Identical sequences A0A1Y6B0T4 A0A229MUT5 B7HTI9 C2S4A7
WP_000276284.1.12751 WP_000276284.1.13299 WP_000276284.1.17408 WP_000276284.1.18840 WP_000276284.1.24377 WP_000276284.1.26499 WP_000276284.1.27334 WP_000276284.1.31685 WP_000276284.1.32522 WP_000276284.1.33061 WP_000276284.1.43762 WP_000276284.1.46746 WP_000276284.1.48164 WP_000276284.1.48311 WP_000276284.1.48599 WP_000276284.1.51087 WP_000276284.1.52756 WP_000276284.1.55057 WP_000276284.1.59773 WP_000276284.1.72514 WP_000276284.1.77576 WP_000276284.1.79658 WP_000276284.1.82986 WP_000276284.1.8923 WP_000276284.1.91404 WP_000276284.1.91615 WP_000276284.1.99266 405534.BCAH187_A2808 gi|217960198|ref|YP_002338758.1| gi|375284712|ref|YP_005105151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]