SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217960338|ref|YP_002338898.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217960338|ref|YP_002338898.1|
Domain Number 1 Region: 5-384
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.57e-105
Family AAT-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217960338|ref|YP_002338898.1|
Sequence length 399
Comment aspartate aminotransferase [Bacillus cereus AH187]
Sequence
MTYTLATRMKAFQSSIFSELGAYKKEKIAAGHKMIDLSIGNPDMPPADFVREEMVHTANQ
KESYGYTLSGIQEFHEAVTEYYNNTHNVILNADKEVLLLMGSQDGLVHLPMVYANPGDII
LVPDPGYTAYETGIQMAGATSYYMPLKKDNDFLPNLELIPEEIADQAKMMILNFPGNPVP
AMAHADFFKEVIAFAKKHNIIVVHDFAYAEFYFDGNKPISFLSVPGAKEVGVEINSLSKS
YSLAGSRIGYMIGNEEIVGALTQFKSNTDYGVFLPIQKAASAALRNGAAFCEKNRAIYQE
RRDTLVDGFRTFGWNVDKPAGSMFVWAEIPKDWTSIDFAYALMDRANVVVTPGHAFGPHG
EGFVRIALVQDKEVLQQVVENIRNSGIFSLEKVDELVKN
Download sequence
Identical sequences A0A0T8Y4T1 A0A1Y6B538 B7HUK8
405534.BCAH187_A2948 gi|375284852|ref|YP_005105291.1| WP_000222667.1.13299 gi|217960338|ref|YP_002338898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]