SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217960390|ref|YP_002338952.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217960390|ref|YP_002338952.1|
Domain Number 1 Region: 4-349
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.25e-73
Family AAT-like 0.0000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217960390|ref|YP_002338952.1|
Sequence length 366
Comment histidinol-phosphate aminotransferase [Bacillus cereus AH187]
Sequence
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHAL
YPDGGATTLRQTIANKLHVQMEQVLCGSGLDEVIQIISRAVLKAGDNIVTAGATFPQYRH
HAIIEGCEVKEVALNNGVYDLDEISSVVDNNTKIVWICNPNNPTGTYVNDRKLTQFIEGI
SENTLIVIDEAYYEYVTAKDFPETLPLLEKHKNILVLRTFSKAYGLASFRVGYAVGHEEL
IEKLNVVRLPFNVSSLAQKAATIAFGDDEFIEEIVRVNTEGLRQYESFCKENEIPFYQSQ
TNFIFLPVENGGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKS
RDEANA
Download sequence
Identical sequences A0A0P0PRG7 A0A1Y6B6S5 A0A229MPX2 A0A243NF77 B7HVI1 C2S4U9 C3C3U6
gi|375284903|ref|YP_005105342.1| gi|217960390|ref|YP_002338952.1| WP_001197247.1.100684 WP_001197247.1.10069 WP_001197247.1.101309 WP_001197247.1.12751 WP_001197247.1.13299 WP_001197247.1.17408 WP_001197247.1.18840 WP_001197247.1.20973 WP_001197247.1.24377 WP_001197247.1.26499 WP_001197247.1.27334 WP_001197247.1.3026 WP_001197247.1.31685 WP_001197247.1.32522 WP_001197247.1.33061 WP_001197247.1.3612 WP_001197247.1.43762 WP_001197247.1.46746 WP_001197247.1.46864 WP_001197247.1.47097 WP_001197247.1.48164 WP_001197247.1.48311 WP_001197247.1.48599 WP_001197247.1.51087 WP_001197247.1.52756 WP_001197247.1.53621 WP_001197247.1.55057 WP_001197247.1.59773 WP_001197247.1.67108 WP_001197247.1.6753 WP_001197247.1.71441 WP_001197247.1.72514 WP_001197247.1.77576 WP_001197247.1.79658 WP_001197247.1.82986 WP_001197247.1.8450 WP_001197247.1.88431 WP_001197247.1.8923 WP_001197247.1.91404 WP_001197247.1.91615 WP_001197247.1.98557 WP_001197247.1.98571 WP_001197247.1.99266 405534.BCAH187_A3002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]