SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217960678|ref|YP_002339242.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217960678|ref|YP_002339242.1|
Domain Number 1 Region: 1-356
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.16e-115
Family GABA-aminotransferase-like 0.0000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217960678|ref|YP_002339242.1|
Sequence length 360
Comment phosphoserine aminotransferase [Bacillus cereus AH187]
Sequence
MERVYNFSAGPSILPLPVLEKVQKELVNYNGTGMSIMEMSHRSSYFQSIIDEAGSLLREL
MNIPDEYEVLFLQGGASLQFSMIPLNLMNTYKKAGYVLTGSWSKKALQEAEKVGEVQVIA
SSENEKFTTIPKLDGLLGDEKLDYVHITTNNTIEGTKYVDIPHVDKVPLVADMSSNILSE
RYDVSKFGLIYAGAQKNLGPAGLTIAIIKRDLIGGADRSCPTMLNYETYSKNNSLYNTPP
SFSIYVTKLVLEWLKEQGGVSAIEEQNRMKSSLLYNFLDESKLFTSPVDPTYRSLMNIPF
TTPSEELNSEFLQKAKERGLVTLKGHRSVGGMRASIYNAMPAHGVQQLVNYMKEFELENR
Download sequence
Identical sequences A0A1Y6B334 A0A229M7Q1 B7HXT1 C2S5V2
405534.BCAH187_A3294 WP_000442932.1.13299 WP_000442932.1.18840 WP_000442932.1.24377 WP_000442932.1.26499 WP_000442932.1.27334 WP_000442932.1.31685 WP_000442932.1.32522 WP_000442932.1.33061 WP_000442932.1.43762 WP_000442932.1.46746 WP_000442932.1.47097 WP_000442932.1.48164 WP_000442932.1.48311 WP_000442932.1.48599 WP_000442932.1.51087 WP_000442932.1.52756 WP_000442932.1.55057 WP_000442932.1.59773 WP_000442932.1.72514 WP_000442932.1.77576 WP_000442932.1.79658 WP_000442932.1.82986 WP_000442932.1.8923 WP_000442932.1.91404 WP_000442932.1.99266 gi|217960678|ref|YP_002339242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]