SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961130|ref|YP_002339698.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961130|ref|YP_002339698.1|
Domain Number 1 Region: 60-398
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.21e-48
Family Cystathionine synthase-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217961130|ref|YP_002339698.1|
Sequence length 423
Comment aluminum resistance protein [Bacillus cereus AH187]
Sequence
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGY
GYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDT
LEEIVGVRGKGVGSFKEYNISYNAVPLTEEGLVDLGAVAAAIHSNTKMIGIQRSKGYATR
PSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIV
KTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFT
AAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPG
YEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELL
TIS
Download sequence
Identical sequences A0A1Y6AJH8 A0A229MRB9 B7HKR1
gi|217961130|ref|YP_002339698.1| WP_000460306.1.13299 WP_000460306.1.18840 WP_000460306.1.24377 WP_000460306.1.26499 WP_000460306.1.27334 WP_000460306.1.31685 WP_000460306.1.32522 WP_000460306.1.33061 WP_000460306.1.43762 WP_000460306.1.47097 WP_000460306.1.48164 WP_000460306.1.48311 WP_000460306.1.48599 WP_000460306.1.51087 WP_000460306.1.52756 WP_000460306.1.55057 WP_000460306.1.59773 WP_000460306.1.72514 WP_000460306.1.77576 WP_000460306.1.79658 WP_000460306.1.82986 WP_000460306.1.8923 WP_000460306.1.91404 WP_000460306.1.99266 405534.BCAH187_A3756 gi|375285632|ref|YP_005106071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]