SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961497|ref|YP_002340067.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961497|ref|YP_002340067.1|
Domain Number 1 Region: 4-382
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-114
Family AAT-like 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217961497|ref|YP_002340067.1|
Sequence length 385
Comment aminotransferase A [Bacillus cereus AH187]
Sequence
MEQFINPRVKDIQISGIRQFSNMIQNYDNLISLTIGQPDFPTPSLVKEAAKRAITENYTS
YTHNAGLLELRKAACNFVKDNYDLHYSPENETIVTIGASEAIDVAFRTILEPGTEVILPA
PIYPGYEPIIRLCGATPIFIDVRETGFRLTAEALEKAITEKTRCVVLPYPSNPTGVTLSK
EELQDIVNVLKDKNIFVLSDEIYSELVYEQTHTSIAHFPEMREKTIVINGLSKSHSMTGW
RIGLLFAPRYLAGHILKVHQYNVTCATSIAQYAAIEALTAAKDAPKMMRHQYKKRRDYVY
NRLIQMGLTVEKPTGAFYLFPYVGHLTSSSFDFALDLVKEAGLAVVPGTAFSEYGEGYLR
LSYAYSIETLKEGCDRLEAFLQQKS
Download sequence
Identical sequences A0A0T8XWH7 A0A1Y6AJT3 A0A229MB78 A0A243NRB2 B7HMY3 C2S894
WP_000434567.1.100684 WP_000434567.1.10069 WP_000434567.1.101309 WP_000434567.1.12751 WP_000434567.1.13299 WP_000434567.1.17408 WP_000434567.1.18840 WP_000434567.1.21172 WP_000434567.1.24377 WP_000434567.1.26499 WP_000434567.1.27334 WP_000434567.1.31685 WP_000434567.1.32522 WP_000434567.1.33061 WP_000434567.1.43762 WP_000434567.1.46746 WP_000434567.1.46864 WP_000434567.1.47097 WP_000434567.1.48164 WP_000434567.1.48311 WP_000434567.1.48599 WP_000434567.1.51087 WP_000434567.1.52756 WP_000434567.1.55057 WP_000434567.1.59773 WP_000434567.1.6753 WP_000434567.1.72514 WP_000434567.1.77576 WP_000434567.1.79658 WP_000434567.1.82986 WP_000434567.1.8450 WP_000434567.1.8923 WP_000434567.1.91404 WP_000434567.1.91615 WP_000434567.1.99266 gi|375286008|ref|YP_005106447.1| 405534.BCAH187_A4133 gi|217961497|ref|YP_002340067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]