SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961527|ref|YP_002340097.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961527|ref|YP_002340097.1|
Domain Number 1 Region: 6-387
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.15e-103
Family AAT-like 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217961527|ref|YP_002340097.1|
Sequence length 392
Comment transaminase [Bacillus cereus AH187]
Sequence
MKSFQPSEIVTSLPTQFFASLVAKVNKVVAAGHDVINLGQGNPDQPTPQHIVKALQDAAD
KTIHHKYPPFRGHESLKEAVATFYQREYDVVVNPKTEVAILFGGKAGLVELPVCFTNPGD
TILVPDPGYPDYLSGVALAKAQFETMPLIAENKFLPDYTKIDDSIAERAKLMFLNYPNNP
TGATASKDFFDETIHFANKHNILVVHDFAYGAIGFDGQKPVSFLQADGAKDTGIEIYTLS
KTFNMAGWRIAFAVGNESVIETINLLQDHMYVSIFGAIQDAAREALLSSQSCVIDLVNSY
ESRRNALISACHSIGWNVDIPTGSFFAWLPVPKGYTSEQFSNILLEKAHVAVAPGVGFGE
YGEGYVRVGLLHTEDRLREAINRIDKLNFFKK
Download sequence
Identical sequences A0A0T8WY57 A0A243NTU7 A0A2A6GBQ1 B7HN13 B9IWP8
gi|222097485|ref|YP_002531542.1| WP_000834735.1.100684 WP_000834735.1.10069 WP_000834735.1.101309 WP_000834735.1.10762 WP_000834735.1.12751 WP_000834735.1.13024 WP_000834735.1.13299 WP_000834735.1.17408 WP_000834735.1.18840 WP_000834735.1.20687 WP_000834735.1.24184 WP_000834735.1.24377 WP_000834735.1.26499 WP_000834735.1.27334 WP_000834735.1.29209 WP_000834735.1.32522 WP_000834735.1.33045 WP_000834735.1.33061 WP_000834735.1.3318 WP_000834735.1.3615 WP_000834735.1.37093 WP_000834735.1.37990 WP_000834735.1.43762 WP_000834735.1.44463 WP_000834735.1.46746 WP_000834735.1.46864 WP_000834735.1.47097 WP_000834735.1.48164 WP_000834735.1.48311 WP_000834735.1.48599 WP_000834735.1.49428 WP_000834735.1.50316 WP_000834735.1.50514 WP_000834735.1.51087 WP_000834735.1.52756 WP_000834735.1.54775 WP_000834735.1.54782 WP_000834735.1.55057 WP_000834735.1.56055 WP_000834735.1.57203 WP_000834735.1.57815 WP_000834735.1.57859 WP_000834735.1.58814 WP_000834735.1.59773 WP_000834735.1.60274 WP_000834735.1.64377 WP_000834735.1.6753 WP_000834735.1.70645 WP_000834735.1.72514 WP_000834735.1.77576 WP_000834735.1.77690 WP_000834735.1.79658 WP_000834735.1.81088 WP_000834735.1.82533 WP_000834735.1.82986 WP_000834735.1.84337 WP_000834735.1.8450 WP_000834735.1.8923 WP_000834735.1.91404 WP_000834735.1.91615 WP_000834735.1.93932 WP_000834735.1.95457 WP_000834735.1.95484 WP_000834735.1.99266 gi|375286041|ref|YP_005106480.1| gi|217961527|ref|YP_002340097.1| 361100.BCQ_3824 405534.BCAH187_A4164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]