SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961611|ref|YP_002340181.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961611|ref|YP_002340181.1|
Domain Number 1 Region: 5-389
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.26e-113
Family GABA-aminotransferase-like 0.00000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217961611|ref|YP_002340181.1|
Sequence length 394
Comment 8-amino-7-oxononanoate synthase [Bacillus cereus AH187]
Sequence
MNQTWRTHLQSKLQQLHEREQYRNLHVTEQAEETWLIRDEKRMLNLASNNYLGLAGDERL
KEAAIACTRKYGTGATASRLVVGNYSLYEEVERSICDWKGTEKALVVNSGYTANIGVISS
LVSRHDIVFSDKLNHASIVDGIILSGAEHKRYGHNDLDHLEKLLKTASPEKRKLIVTDTV
FSMDGDTAYLRELVELKEKYGAILIVDEAHASGIYGIGGAGLSHIEDLAQKIDIHMGTFS
KALGCYGAYLTGDAIYIEYLHNMMRSFIFTTALPPGTLGAVQKAIEIVQEDHKRRENLIA
NGEYFRSKLRDAGFNIGNSSTHIVPIVVGSNENALRFSKRLQEAGIAAIAIRPPTVPINS
SRIRFAVTSQHTIADLKWAIDRIIHIAKEEELFV
Download sequence
Identical sequences A0A1Y5ZX93 A0A229MX47 B7HNN4 B9IWY0
gi|375286127|ref|YP_005106566.1| gi|222097567|ref|YP_002531624.1| 361100.BCQ_3907 405534.BCAH187_A4251 WP_001077307.1.10762 WP_001077307.1.13024 WP_001077307.1.13299 WP_001077307.1.18840 WP_001077307.1.20687 WP_001077307.1.24184 WP_001077307.1.24377 WP_001077307.1.26499 WP_001077307.1.27334 WP_001077307.1.29209 WP_001077307.1.31685 WP_001077307.1.32522 WP_001077307.1.33045 WP_001077307.1.33061 WP_001077307.1.3318 WP_001077307.1.3615 WP_001077307.1.37093 WP_001077307.1.37990 WP_001077307.1.43762 WP_001077307.1.44463 WP_001077307.1.46746 WP_001077307.1.47097 WP_001077307.1.48164 WP_001077307.1.48311 WP_001077307.1.48599 WP_001077307.1.49428 WP_001077307.1.50316 WP_001077307.1.50514 WP_001077307.1.51087 WP_001077307.1.52756 WP_001077307.1.54775 WP_001077307.1.54782 WP_001077307.1.55057 WP_001077307.1.56055 WP_001077307.1.57203 WP_001077307.1.57815 WP_001077307.1.57859 WP_001077307.1.58814 WP_001077307.1.59773 WP_001077307.1.60274 WP_001077307.1.64377 WP_001077307.1.70645 WP_001077307.1.72514 WP_001077307.1.77576 WP_001077307.1.77690 WP_001077307.1.79658 WP_001077307.1.81088 WP_001077307.1.82533 WP_001077307.1.82986 WP_001077307.1.84337 WP_001077307.1.8923 WP_001077307.1.91404 WP_001077307.1.93932 WP_001077307.1.95457 WP_001077307.1.95484 WP_001077307.1.99266 gi|217961611|ref|YP_002340181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]