SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961717|ref|YP_002340287.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961717|ref|YP_002340287.1|
Domain Number 1 Region: 3-445
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.16e-120
Family Glycine dehydrogenase subunits (GDC-P) 0.0000000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217961717|ref|YP_002340287.1|
Sequence length 447
Comment glycine dehydrogenase subunit 1 [Bacillus cereus AH187]
Sequence
MLHRYLPMTEEDKKEMLQTIGVQTIDELFSDIPESVRFKGDLKIKEAKSEPELLKELSQM
ASKNANLKEYASFLGAGVYDHYAPVIVDHVISRSEFYTAYTPYQPEISQGELQAIFEFQT
MICELTGMDVANSSMYDGGTALAEAAMLAAGHTRKKKILVSSAVHPESRAVLETYAKGQH
LEVVEINHKDGVTDLDVLQSEVDDTVACVIVQYPNFFGQVEKLADIEKIVHQQKSLFIVS
SNPLSLGALTPPGKFGADIVIGDAQPFGIPTQFGGPHCGYFATTKAFMRKIPGRLVGQTV
DSDGKRGFVLTLQAREQHIRRDKATSNICSNQALNALAASVAMTALGKQGVKEMARQNIS
KAQYAKRQFEAKGFTVTFAGPFFNEFVVDCKRPVKEVNDALLQKNIIGGYDLGRDYKEHE
NHMLVAVTELRTKDEIDTLVNEMGAIQ
Download sequence
Identical sequences A0A0T8X906 A0A1Y6A0B9 A0A229MXA6 A0A243I3Y9 A0A2K1S0U9 B7HNZ0 B9IXL8 C2S8W0 J8H2H6 J8JKL3
gi|217961717|ref|YP_002340287.1| 361100.BCQ_4011 405534.BCAH187_A4357 gi|222097671|ref|YP_002531728.1| WP_000903230.1.101843 WP_000903230.1.10762 WP_000903230.1.11044 WP_000903230.1.12751 WP_000903230.1.13024 WP_000903230.1.13299 WP_000903230.1.17899 WP_000903230.1.18840 WP_000903230.1.195 WP_000903230.1.20687 WP_000903230.1.24184 WP_000903230.1.24377 WP_000903230.1.24709 WP_000903230.1.26499 WP_000903230.1.27334 WP_000903230.1.29209 WP_000903230.1.31685 WP_000903230.1.32522 WP_000903230.1.33045 WP_000903230.1.33061 WP_000903230.1.3318 WP_000903230.1.3615 WP_000903230.1.37093 WP_000903230.1.37990 WP_000903230.1.38425 WP_000903230.1.41976 WP_000903230.1.43762 WP_000903230.1.44463 WP_000903230.1.46244 WP_000903230.1.46746 WP_000903230.1.46864 WP_000903230.1.47097 WP_000903230.1.47441 WP_000903230.1.48010 WP_000903230.1.48164 WP_000903230.1.48311 WP_000903230.1.48599 WP_000903230.1.49428 WP_000903230.1.50316 WP_000903230.1.50514 WP_000903230.1.51087 WP_000903230.1.52756 WP_000903230.1.54775 WP_000903230.1.54782 WP_000903230.1.55057 WP_000903230.1.56055 WP_000903230.1.5628 WP_000903230.1.57203 WP_000903230.1.57815 WP_000903230.1.57859 WP_000903230.1.58037 WP_000903230.1.58814 WP_000903230.1.59773 WP_000903230.1.60274 WP_000903230.1.64377 WP_000903230.1.67108 WP_000903230.1.70645 WP_000903230.1.72514 WP_000903230.1.77576 WP_000903230.1.77690 WP_000903230.1.79250 WP_000903230.1.79658 WP_000903230.1.80955 WP_000903230.1.81088 WP_000903230.1.82533 WP_000903230.1.82986 WP_000903230.1.84337 WP_000903230.1.8923 WP_000903230.1.91404 WP_000903230.1.91615 WP_000903230.1.93932 WP_000903230.1.95457 WP_000903230.1.95484 WP_000903230.1.98571 WP_000903230.1.99266 gi|375286233|ref|YP_005106672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]