SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961748|ref|YP_002340318.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961748|ref|YP_002340318.1|
Domain Number 1 Region: 16-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.41e-108
Family Cystathionine synthase-like 0.0000000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217961748|ref|YP_002340318.1|
Sequence length 387
Comment cystathionine beta-lyase [Bacillus cereus AH187]
Sequence
MSYSIDTLLLHNQYKHDSQTGAVNVPIYNTSTFHQFDVDTFGKYDYSRSGNPTREALEDI
IALLEGGTKGFAFASGIAAISTAFLLLSQGDHVLISEDVYGGTYRMITEVLSRYGVSHTF
VDMTNLEEIKQNIKPNTKLFYVETPSNPLLKVTDIRAVSKLAKSIGALTFVDNTFLTPLF
QKPLDLGADVVLHSATKFIAGHSDVTAGLAVVKDTDLAQKLGFLQNSFGAILGPQDCSLV
LRGLKTLHVRLEHSAANANKIAHYLQEHAKVQNVYYPGLQTHLGFNIQQSQATSAGAVLS
FTLQSEDALRQFLSKVKLPVFAVSLGAVESILSYPAKMSHAALSQEARDERGISNSLLRL
SVGLENVDDLISDFENALSYVEEPVNA
Download sequence
Identical sequences A0A0F5RS93 A0A151V2L0 A0A229MX36 A0A243I4T2 A0A243NWF3 B7HPF7 B9IXP9 J8G8A8 J8GE52
361100.BCQ_4042 405534.BCAH187_A4390 gi|402555607|ref|YP_006596878.1| gi|375286263|ref|YP_005106702.1| gi|217961748|ref|YP_002340318.1| WP_000122291.1.100684 WP_000122291.1.10069 WP_000122291.1.100873 WP_000122291.1.101309 WP_000122291.1.101550 WP_000122291.1.101843 WP_000122291.1.10762 WP_000122291.1.11060 WP_000122291.1.12751 WP_000122291.1.13024 WP_000122291.1.13299 WP_000122291.1.16199 WP_000122291.1.17408 WP_000122291.1.17899 WP_000122291.1.17927 WP_000122291.1.1850 WP_000122291.1.18840 WP_000122291.1.19173 WP_000122291.1.20687 WP_000122291.1.21172 WP_000122291.1.23110 WP_000122291.1.23200 WP_000122291.1.24184 WP_000122291.1.24377 WP_000122291.1.24709 WP_000122291.1.25757 WP_000122291.1.26499 WP_000122291.1.27334 WP_000122291.1.29209 WP_000122291.1.31685 WP_000122291.1.32522 WP_000122291.1.33045 WP_000122291.1.33061 WP_000122291.1.3318 WP_000122291.1.35255 WP_000122291.1.3615 WP_000122291.1.37093 WP_000122291.1.37990 WP_000122291.1.38425 WP_000122291.1.41976 WP_000122291.1.42165 WP_000122291.1.43533 WP_000122291.1.43762 WP_000122291.1.44463 WP_000122291.1.46746 WP_000122291.1.46864 WP_000122291.1.47097 WP_000122291.1.47441 WP_000122291.1.48010 WP_000122291.1.48164 WP_000122291.1.48311 WP_000122291.1.48599 WP_000122291.1.49056 WP_000122291.1.49428 WP_000122291.1.50316 WP_000122291.1.50514 WP_000122291.1.51087 WP_000122291.1.52756 WP_000122291.1.54775 WP_000122291.1.54782 WP_000122291.1.55057 WP_000122291.1.56055 WP_000122291.1.5628 WP_000122291.1.57203 WP_000122291.1.57245 WP_000122291.1.57565 WP_000122291.1.57815 WP_000122291.1.57859 WP_000122291.1.58037 WP_000122291.1.58814 WP_000122291.1.59052 WP_000122291.1.59773 WP_000122291.1.60274 WP_000122291.1.64377 WP_000122291.1.64706 WP_000122291.1.65983 WP_000122291.1.6753 WP_000122291.1.69970 WP_000122291.1.70645 WP_000122291.1.71648 WP_000122291.1.72514 WP_000122291.1.77370 WP_000122291.1.77576 WP_000122291.1.77690 WP_000122291.1.77902 WP_000122291.1.79250 WP_000122291.1.79658 WP_000122291.1.79687 WP_000122291.1.80239 WP_000122291.1.80571 WP_000122291.1.80955 WP_000122291.1.81088 WP_000122291.1.82533 WP_000122291.1.82986 WP_000122291.1.83070 WP_000122291.1.84337 WP_000122291.1.8450 WP_000122291.1.86082 WP_000122291.1.87627 WP_000122291.1.8923 WP_000122291.1.89675 WP_000122291.1.90671 WP_000122291.1.91080 WP_000122291.1.91404 WP_000122291.1.91569 WP_000122291.1.91615 WP_000122291.1.93932 WP_000122291.1.95457 WP_000122291.1.95484 WP_000122291.1.95786 WP_000122291.1.96356 WP_000122291.1.97617 WP_000122291.1.99266 gi|222097702|ref|YP_002531759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]