SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961862|ref|YP_002340432.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961862|ref|YP_002340432.1|
Domain Number 1 Region: 16-376
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.93e-120
Family Cystathionine synthase-like 0.0000000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217961862|ref|YP_002340432.1|
Sequence length 377
Comment cystathionine beta-lyase [Bacillus cereus AH187]
Sequence
MRAKTKLIHGIRIGEPSTGSVNVPIYQTSTYKQEAVGKHQGYEYSRTGNPTRAALEEMIA
VLENGHAGFAFGSGMAAITATIMLFSKGDHVILTDDVYGGTYRVITKVLNRFGIEHTFVD
TTNLEEVEEAIRPNTKAIYVETPTNPLLKITDIKKISTLAKEKDLLTIIDNTFMTPYWQS
PISLGADIVLHSATKYLGGHSDVVAGLVVVNSPQLAEDLHFVQNSTGGILGPQDSFLLLR
GLKTLGIRMEEHETNSRAIAEFLNNHPKVNKVYYPGLESHQNHELATEQANGFGAIISFD
VDSEETLNKVLERLQYFTLAESLGAVESLISIPSQMTHASIPADRRKELGITDTLIRISV
GIEDGEDLIEDLAQALA
Download sequence
Identical sequences A0A0T8W950 A0A1J9WSX3 A0A1J9ZV45 A0A1T2Q8F0 A0A229MWL1 A0A243NLJ0 B7HQD0 B9IYD7 C2S9A7 J8GDS6
361100.BCQ_4156 405534.BCAH187_A4505 gi|222097815|ref|YP_002531872.1| gi|375286376|ref|YP_005106815.1| gi|217961862|ref|YP_002340432.1| WP_001201909.1.100684 WP_001201909.1.10069 WP_001201909.1.100873 WP_001201909.1.101309 WP_001201909.1.101843 WP_001201909.1.10762 WP_001201909.1.11044 WP_001201909.1.12751 WP_001201909.1.13024 WP_001201909.1.13299 WP_001201909.1.17408 WP_001201909.1.18840 WP_001201909.1.20665 WP_001201909.1.20687 WP_001201909.1.24184 WP_001201909.1.24377 WP_001201909.1.26499 WP_001201909.1.27334 WP_001201909.1.29209 WP_001201909.1.31685 WP_001201909.1.32522 WP_001201909.1.33045 WP_001201909.1.33061 WP_001201909.1.3318 WP_001201909.1.3615 WP_001201909.1.37093 WP_001201909.1.37990 WP_001201909.1.43533 WP_001201909.1.43762 WP_001201909.1.44463 WP_001201909.1.46244 WP_001201909.1.46746 WP_001201909.1.46864 WP_001201909.1.47097 WP_001201909.1.48164 WP_001201909.1.48311 WP_001201909.1.48599 WP_001201909.1.49428 WP_001201909.1.50316 WP_001201909.1.50514 WP_001201909.1.51087 WP_001201909.1.51167 WP_001201909.1.52756 WP_001201909.1.54775 WP_001201909.1.54782 WP_001201909.1.55057 WP_001201909.1.56055 WP_001201909.1.5628 WP_001201909.1.57203 WP_001201909.1.57815 WP_001201909.1.57859 WP_001201909.1.58814 WP_001201909.1.59773 WP_001201909.1.60274 WP_001201909.1.64377 WP_001201909.1.6753 WP_001201909.1.70645 WP_001201909.1.72514 WP_001201909.1.74337 WP_001201909.1.77576 WP_001201909.1.77690 WP_001201909.1.79658 WP_001201909.1.80955 WP_001201909.1.81088 WP_001201909.1.82421 WP_001201909.1.82533 WP_001201909.1.82986 WP_001201909.1.84337 WP_001201909.1.8450 WP_001201909.1.87627 WP_001201909.1.8923 WP_001201909.1.91404 WP_001201909.1.91615 WP_001201909.1.93932 WP_001201909.1.95457 WP_001201909.1.95484 WP_001201909.1.99266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]