SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961887|ref|YP_002340457.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961887|ref|YP_002340457.1|
Domain Number 1 Region: 3-374
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.05e-106
Family Cystathionine synthase-like 0.00000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217961887|ref|YP_002340457.1|
Sequence length 381
Comment class V aminotransferase [Bacillus cereus AH187]
Sequence
MERIYLDHAATSPTHPEVVEKMIPYMTETFGNPSSIHFYGRQTRHAVDEARRACARSIHA
NPNEIIFTSGGTEADNLALIGVARANRHKGNHIITTQIEHHAILHTCELLEREGFEVTYL
PVDETGRVQVSDIQKALTEETILVSIMFGNNEVGTMQPIAEIGKLLKEHQAYFHTDAVQA
YGLVEINVKEFGIDLLSISAHKINGPKGVGFLYAGANVKFEPLLIGGEQERKRRAGTENV
PSIVGLHHAILLAEKTREQKNAQYEEFKDIMVSVFKNEDITFEVNGNLEYRLPHVLNISF
TGMNIEPFLVNLDLAGIAVSSGSACTAGSIDPSHVLVAMFGKDSDQIRSSVRFSFGLGNT
KEQVEKAAYETVKIVKRLTQN
Download sequence
Identical sequences A0A0T8P4X3 A0A1Y5ZZX9 A0A243NLS5 B7HQF5 B9IYG2 C2S9D2
gi|375286401|ref|YP_005106840.1| 361100.BCQ_4181 405534.BCAH187_A4530 gi|222097840|ref|YP_002531897.1| WP_000439906.1.100684 WP_000439906.1.10069 WP_000439906.1.101309 WP_000439906.1.10762 WP_000439906.1.12751 WP_000439906.1.13024 WP_000439906.1.13299 WP_000439906.1.17408 WP_000439906.1.18840 WP_000439906.1.20687 WP_000439906.1.24184 WP_000439906.1.24377 WP_000439906.1.26499 WP_000439906.1.27334 WP_000439906.1.29209 WP_000439906.1.32522 WP_000439906.1.33045 WP_000439906.1.33061 WP_000439906.1.3318 WP_000439906.1.3615 WP_000439906.1.37093 WP_000439906.1.37990 WP_000439906.1.43762 WP_000439906.1.44463 WP_000439906.1.46746 WP_000439906.1.46864 WP_000439906.1.47097 WP_000439906.1.48164 WP_000439906.1.48311 WP_000439906.1.48599 WP_000439906.1.49428 WP_000439906.1.50316 WP_000439906.1.50514 WP_000439906.1.51087 WP_000439906.1.52756 WP_000439906.1.54775 WP_000439906.1.54782 WP_000439906.1.55057 WP_000439906.1.56055 WP_000439906.1.57203 WP_000439906.1.57815 WP_000439906.1.57859 WP_000439906.1.58814 WP_000439906.1.59773 WP_000439906.1.60274 WP_000439906.1.64377 WP_000439906.1.6753 WP_000439906.1.70645 WP_000439906.1.77576 WP_000439906.1.77690 WP_000439906.1.79658 WP_000439906.1.81088 WP_000439906.1.82533 WP_000439906.1.82986 WP_000439906.1.84337 WP_000439906.1.8450 WP_000439906.1.8923 WP_000439906.1.91404 WP_000439906.1.91615 WP_000439906.1.93932 WP_000439906.1.95457 WP_000439906.1.95484 WP_000439906.1.99266 gi|217961887|ref|YP_002340457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]