SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217961953|ref|YP_002340523.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217961953|ref|YP_002340523.1|
Domain Number 1 Region: 4-426
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.49e-131
Family GABA-aminotransferase-like 0.000000000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217961953|ref|YP_002340523.1|
Sequence length 429
Comment glutamate-1-semialdehyde aminotransferase [Bacillus cereus AH187]
Sequence
MKKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVL
SWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTE
ATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTI
TVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFD
EVMTGFRVAYNCGQGYYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGT
LSGNPLAMAAGYETLVQLTPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIF
FTDEPVINYDAAKSSNLEFFAAYYREMVEQGVFLPPSQFEGLFLSTAHSDADIEATIAAA
EIAMSKLKA
Download sequence
Identical sequences A0A0E1MLA6 A0A0T8WC14 A0A1J9UDG0 A0A229MW89 A0A242YCN8 A0A243C901 A0A243IMN0 A0A243NLS8 A0A246UDI7 A0A2A8L4Y5 A0A2B3J248 B7HQM1 B9IZ36 C2QYW5 C2S9J7 C3C8H8
361100.BCQ_4248 405534.BCAH187_A4597 WP_000712928.1.100684 WP_000712928.1.10069 WP_000712928.1.10762 WP_000712928.1.12751 WP_000712928.1.13024 WP_000712928.1.13299 WP_000712928.1.17408 WP_000712928.1.18840 WP_000712928.1.195 WP_000712928.1.20665 WP_000712928.1.20687 WP_000712928.1.20973 WP_000712928.1.226 WP_000712928.1.24182 WP_000712928.1.24184 WP_000712928.1.24377 WP_000712928.1.2521 WP_000712928.1.26499 WP_000712928.1.27334 WP_000712928.1.28913 WP_000712928.1.29209 WP_000712928.1.30317 WP_000712928.1.31503 WP_000712928.1.31685 WP_000712928.1.32522 WP_000712928.1.33045 WP_000712928.1.33061 WP_000712928.1.3318 WP_000712928.1.35518 WP_000712928.1.3561 WP_000712928.1.3612 WP_000712928.1.3615 WP_000712928.1.37093 WP_000712928.1.37626 WP_000712928.1.37990 WP_000712928.1.38517 WP_000712928.1.40839 WP_000712928.1.43762 WP_000712928.1.44463 WP_000712928.1.46746 WP_000712928.1.46864 WP_000712928.1.47097 WP_000712928.1.47936 WP_000712928.1.48164 WP_000712928.1.48599 WP_000712928.1.49428 WP_000712928.1.50316 WP_000712928.1.50514 WP_000712928.1.51087 WP_000712928.1.51335 WP_000712928.1.52494 WP_000712928.1.52756 WP_000712928.1.53621 WP_000712928.1.54775 WP_000712928.1.54782 WP_000712928.1.55057 WP_000712928.1.56055 WP_000712928.1.57203 WP_000712928.1.57815 WP_000712928.1.57859 WP_000712928.1.58814 WP_000712928.1.59773 WP_000712928.1.60274 WP_000712928.1.61944 WP_000712928.1.62107 WP_000712928.1.6340 WP_000712928.1.64377 WP_000712928.1.66932 WP_000712928.1.67108 WP_000712928.1.6753 WP_000712928.1.70645 WP_000712928.1.71953 WP_000712928.1.72514 WP_000712928.1.7398 WP_000712928.1.7628 WP_000712928.1.77576 WP_000712928.1.77690 WP_000712928.1.77902 WP_000712928.1.79658 WP_000712928.1.79687 WP_000712928.1.81088 WP_000712928.1.82533 WP_000712928.1.82986 WP_000712928.1.84337 WP_000712928.1.84422 WP_000712928.1.8450 WP_000712928.1.88431 WP_000712928.1.8923 WP_000712928.1.91404 WP_000712928.1.91615 WP_000712928.1.93932 WP_000712928.1.95457 WP_000712928.1.95484 WP_000712928.1.98519 WP_000712928.1.98571 WP_000712928.1.99266 gi|375286465|ref|YP_005106904.1| gi|222097907|ref|YP_002531964.1| gi|217961953|ref|YP_002340523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]