SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217962136|ref|YP_002340706.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217962136|ref|YP_002340706.1|
Domain Number 1 Region: 1-372
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.81e-100
Family Cystathionine synthase-like 0.000000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217962136|ref|YP_002340706.1|
Sequence length 380
Comment class V aminotransferase [Bacillus cereus AH187]
Sequence
MIYFDNSATTKPYPEALQSYVTVAGKYFGNPSSIHSLGGEAERLLTQSRTIAAQLLHVKP
SEIIFTSGGTEGNNLAIKGIAMRNRSRGKHIITTNIEHASVFEAYKQLEDLGFDVTYLPV
NEHGVVSVEDVKRALREDTILVSIIHVNNETGAIQPVAEIGTLLSNYPKIRFHVDHVQGI
GKVPLNLYASHIDLCSISGHKFHSVKGTGLLYVRDGVRLDPILSGGQQELKYRSGTENLP
GIVAMVKALRMTMEQVKEKVAHLQSLQAELVRFFKEMEDVTINTSLAYAAPHILNVSFVG
LKPEVVVHALEEHGVYVSTKSACSSKANEVSRVLVSMGVPHAAAASAIRISLAPENTMEE
VKQFEGIVKETMPKLYEVMR
Download sequence
Identical sequences A0A0E1MEL2 A0A0F5RSQ7 A0A0T8W1I7 A0A137S0A6 A0A154AWL0 A0A1J9UXA6 A0A1J9Y9U0 A0A1J9Z2K9 A0A229MX58 A0A243CMN6 A0A243I5V3 A0A243IH83 A0A243NPX9 A0A2A8WWS3 A0A2B4EN46 B7HSI5 B9J152 C2MRV7 C2S9Z4 J8GI48 J8J616 Q6HCM9 Q72Z84 Q81KT9
gi|227817439|ref|YP_002817448.1| 198094.BA_4900 222523.BCE_4785 260799.BAS4546 261594.GBAA4900 281309.BT9727_4382 361100.BCQ_4464 405534.BCAH187_A4783 568206.BAMEG_4931 592021.BAA_4910 gi|222098122|ref|YP_002532179.1| gi|30264722|ref|NP_847099.1| gi|47530194|ref|YP_021543.1| gi|42783831|ref|NP_981078.1| gi|402555223|ref|YP_006596494.1| gi|49187540|ref|YP_030793.1| NP_847099.1.87267 WP_000638965.1.100214 WP_000638965.1.100409 WP_000638965.1.100595 WP_000638965.1.100684 WP_000638965.1.10069 WP_000638965.1.100873 WP_000638965.1.101309 WP_000638965.1.101550 WP_000638965.1.101843 WP_000638965.1.10208 WP_000638965.1.10762 WP_000638965.1.11044 WP_000638965.1.11060 WP_000638965.1.11427 WP_000638965.1.11676 WP_000638965.1.1228 WP_000638965.1.12289 WP_000638965.1.12751 WP_000638965.1.13024 WP_000638965.1.13115 WP_000638965.1.13233 WP_000638965.1.13299 WP_000638965.1.13820 WP_000638965.1.14721 WP_000638965.1.14855 WP_000638965.1.15460 WP_000638965.1.15569 WP_000638965.1.16170 WP_000638965.1.16199 WP_000638965.1.16997 WP_000638965.1.17146 WP_000638965.1.17408 WP_000638965.1.17899 WP_000638965.1.1850 WP_000638965.1.18840 WP_000638965.1.18976 WP_000638965.1.19173 WP_000638965.1.19258 WP_000638965.1.19435 WP_000638965.1.195 WP_000638965.1.20390 WP_000638965.1.20680 WP_000638965.1.20687 WP_000638965.1.21021 WP_000638965.1.21172 WP_000638965.1.21258 WP_000638965.1.21643 WP_000638965.1.21776 WP_000638965.1.226 WP_000638965.1.22865 WP_000638965.1.23110 WP_000638965.1.23200 WP_000638965.1.23269 WP_000638965.1.24184 WP_000638965.1.2419 WP_000638965.1.24334 WP_000638965.1.24377 WP_000638965.1.24556 WP_000638965.1.24608 WP_000638965.1.24709 WP_000638965.1.24759 WP_000638965.1.25716 WP_000638965.1.25752 WP_000638965.1.25757 WP_000638965.1.2618 WP_000638965.1.26499 WP_000638965.1.26665 WP_000638965.1.26721 WP_000638965.1.27334 WP_000638965.1.27644 WP_000638965.1.27987 WP_000638965.1.28427 WP_000638965.1.28729 WP_000638965.1.28913 WP_000638965.1.29101 WP_000638965.1.29209 WP_000638965.1.29787 WP_000638965.1.30110 WP_000638965.1.30317 WP_000638965.1.31490 WP_000638965.1.31503 WP_000638965.1.31685 WP_000638965.1.3236 WP_000638965.1.32522 WP_000638965.1.32576 WP_000638965.1.33045 WP_000638965.1.33061 WP_000638965.1.3318 WP_000638965.1.33338 WP_000638965.1.33367 WP_000638965.1.33740 WP_000638965.1.33876 WP_000638965.1.34158 WP_000638965.1.34646 WP_000638965.1.35255 WP_000638965.1.35684 WP_000638965.1.35886 WP_000638965.1.3615 WP_000638965.1.36305 WP_000638965.1.36763 WP_000638965.1.37093 WP_000638965.1.37626 WP_000638965.1.37990 WP_000638965.1.38036 WP_000638965.1.38425 WP_000638965.1.39001 WP_000638965.1.39781 WP_000638965.1.40550 WP_000638965.1.40839 WP_000638965.1.41165 WP_000638965.1.41675 WP_000638965.1.41976 WP_000638965.1.42165 WP_000638965.1.43104 WP_000638965.1.43533 WP_000638965.1.43762 WP_000638965.1.4439 WP_000638965.1.44463 WP_000638965.1.45089 WP_000638965.1.45305 WP_000638965.1.45385 WP_000638965.1.45533 WP_000638965.1.46236 WP_000638965.1.46244 WP_000638965.1.46699 WP_000638965.1.46746 WP_000638965.1.46864 WP_000638965.1.47097 WP_000638965.1.47145 WP_000638965.1.47441 WP_000638965.1.4763 WP_000638965.1.47798 WP_000638965.1.48010 WP_000638965.1.48164 WP_000638965.1.48311 WP_000638965.1.48599 WP_000638965.1.49056 WP_000638965.1.49428 WP_000638965.1.49802 WP_000638965.1.50316 WP_000638965.1.50514 WP_000638965.1.51087 WP_000638965.1.51335 WP_000638965.1.52756 WP_000638965.1.52794 WP_000638965.1.53137 WP_000638965.1.53493 WP_000638965.1.53683 WP_000638965.1.54117 WP_000638965.1.54189 WP_000638965.1.54775 WP_000638965.1.54782 WP_000638965.1.55057 WP_000638965.1.55811 WP_000638965.1.55958 WP_000638965.1.56042 WP_000638965.1.56055 WP_000638965.1.56176 WP_000638965.1.56270 WP_000638965.1.5628 WP_000638965.1.56959 WP_000638965.1.57203 WP_000638965.1.57245 WP_000638965.1.57565 WP_000638965.1.57815 WP_000638965.1.57859 WP_000638965.1.58037 WP_000638965.1.58160 WP_000638965.1.58328 WP_000638965.1.58814 WP_000638965.1.59095 WP_000638965.1.59310 WP_000638965.1.59575 WP_000638965.1.59773 WP_000638965.1.60274 WP_000638965.1.60402 WP_000638965.1.60781 WP_000638965.1.61213 WP_000638965.1.61231 WP_000638965.1.61944 WP_000638965.1.6340 WP_000638965.1.63560 WP_000638965.1.63611 WP_000638965.1.64377 WP_000638965.1.64706 WP_000638965.1.65758 WP_000638965.1.65983 WP_000638965.1.66331 WP_000638965.1.66932 WP_000638965.1.67108 WP_000638965.1.6753 WP_000638965.1.68607 WP_000638965.1.69203 WP_000638965.1.69822 WP_000638965.1.69894 WP_000638965.1.69970 WP_000638965.1.70065 WP_000638965.1.70645 WP_000638965.1.70996 WP_000638965.1.71441 WP_000638965.1.71648 WP_000638965.1.72514 WP_000638965.1.72704 WP_000638965.1.73325 WP_000638965.1.7398 WP_000638965.1.74226 WP_000638965.1.74538 WP_000638965.1.75499 WP_000638965.1.75870 WP_000638965.1.76125 WP_000638965.1.7628 WP_000638965.1.76783 WP_000638965.1.77370 WP_000638965.1.77576 WP_000638965.1.77668 WP_000638965.1.77690 WP_000638965.1.77824 WP_000638965.1.77902 WP_000638965.1.78644 WP_000638965.1.79043 WP_000638965.1.79250 WP_000638965.1.79252 WP_000638965.1.79315 WP_000638965.1.79584 WP_000638965.1.79658 WP_000638965.1.80239 WP_000638965.1.80439 WP_000638965.1.80571 WP_000638965.1.80695 WP_000638965.1.80955 WP_000638965.1.81088 WP_000638965.1.81799 WP_000638965.1.82289 WP_000638965.1.82421 WP_000638965.1.82533 WP_000638965.1.82986 WP_000638965.1.83070 WP_000638965.1.83951 WP_000638965.1.84045 WP_000638965.1.84337 WP_000638965.1.8450 WP_000638965.1.85689 WP_000638965.1.86082 WP_000638965.1.86119 WP_000638965.1.86140 WP_000638965.1.86239 WP_000638965.1.86288 WP_000638965.1.8698 WP_000638965.1.87627 WP_000638965.1.8825 WP_000638965.1.88641 WP_000638965.1.8923 WP_000638965.1.90671 WP_000638965.1.90791 WP_000638965.1.90883 WP_000638965.1.91080 WP_000638965.1.91404 WP_000638965.1.91615 WP_000638965.1.9186 WP_000638965.1.92347 WP_000638965.1.92686 WP_000638965.1.92831 WP_000638965.1.93271 WP_000638965.1.93744 WP_000638965.1.93927 WP_000638965.1.93932 WP_000638965.1.94237 WP_000638965.1.94322 WP_000638965.1.94373 WP_000638965.1.94784 WP_000638965.1.95308 WP_000638965.1.95457 WP_000638965.1.95484 WP_000638965.1.96356 WP_000638965.1.96934 WP_000638965.1.97781 WP_000638965.1.97861 WP_000638965.1.98216 WP_000638965.1.98519 WP_000638965.1.99266 WP_000638965.1.99445 WP_000638965.1.99485 YP_030793.1.16718 YP_038697.1.62562 gi|229604274|ref|YP_002868930.1| gi|49481400|ref|YP_038697.1| gi|386738548|ref|YP_006211729.1| gi|217962136|ref|YP_002340706.1| gi|375286651|ref|YP_005107090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]