SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217962142|ref|YP_002340712.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217962142|ref|YP_002340712.1|
Domain Number 1 Region: 26-386
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.16e-118
Family Cystathionine synthase-like 0.0000000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217962142|ref|YP_002340712.1|
Sequence length 392
Comment methionine gamma-lyase [Bacillus cereus AH187]
Sequence
MKKKHMETALIHHGYTSEAHKGSLTPPLFQTSTFTFETAQQGEASFAGVDPSYIYSRLGN
PTVKLFEERMAVLEGGEEALAFGSGMAAISATLIGFLKAGDHIICSNGLYGCTYGFLEVL
EEKFMITHSFCDMETEADMENKIRPNTKLIFVETPINPTMKLIDLKQVIRVAKRNGLLVI
VDNTFCSPYLQRPLELGCDAVVHSATKYIGGHGDVVAGVTICKTKALAEKIRPMRKDIGG
IMAPFDAWLLLRGLKTLAVRMDRHCDNAEKIVSFLKNHDAVEGVWYPEGELASRQMKRGG
GVISFSIKGGKEETQAFINDLHFITIAVSLGDTETLIQHPATMTHAAIPAALRQEMGIYD
NLIRLSVGLESWEDIVSDLEQALKKISTVSNQ
Download sequence
Identical sequences A0A229MVU2 A0A243I736 A0A243NMD7 A0A2A6GAA1 A0A2K1RP62 B7HSJ1 C2MRW3 C2S9Q4 J8H687
gi|217962142|ref|YP_002340712.1| 405534.BCAH187_A4789 WP_000726578.1.100684 WP_000726578.1.10069 WP_000726578.1.100873 WP_000726578.1.101309 WP_000726578.1.101843 WP_000726578.1.12751 WP_000726578.1.13299 WP_000726578.1.16199 WP_000726578.1.17408 WP_000726578.1.17899 WP_000726578.1.18840 WP_000726578.1.24377 WP_000726578.1.24709 WP_000726578.1.26499 WP_000726578.1.27334 WP_000726578.1.31685 WP_000726578.1.32522 WP_000726578.1.33061 WP_000726578.1.43533 WP_000726578.1.43762 WP_000726578.1.46746 WP_000726578.1.47097 WP_000726578.1.47441 WP_000726578.1.48164 WP_000726578.1.48311 WP_000726578.1.48599 WP_000726578.1.51087 WP_000726578.1.52756 WP_000726578.1.55057 WP_000726578.1.5628 WP_000726578.1.57565 WP_000726578.1.59773 WP_000726578.1.6753 WP_000726578.1.72514 WP_000726578.1.77576 WP_000726578.1.79250 WP_000726578.1.79658 WP_000726578.1.80955 WP_000726578.1.82986 WP_000726578.1.8450 WP_000726578.1.8923 WP_000726578.1.91615 WP_000726578.1.99266 gi|375286657|ref|YP_005107096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]