SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217962336|ref|YP_002340908.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217962336|ref|YP_002340908.1|
Domain Number 1 Region: 10-363
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.41e-39
Family GABA-aminotransferase-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217962336|ref|YP_002340908.1|
Sequence length 367
Comment putative pyridoxal phosphate-dependent enzyme [Bacillus cereus AH187]
Sequence
MGYSLNAKYGLKRVINASGRMSILGVSAPTDTVMDAMKHGGQNYVEIADLVDKAGDHIAR
ILDAEAAVVVNSASSGIALSIAAIVTEGNRRKSERLHQEVIAKNEVIMLKGHNVQYGAPV
ETMIYLGGGKLVEVGYANEGKAEHIEDAIGENTAAILYVKSHHAVQKNMISVEEAWEVAQ
RNNVPLIVDAAAEEDIQKYVKYSDLAIYSGSKAIEGPTSGIVGGKRKYIEWLKVQLHCIG
RSMKVGKETTFGLLQALDEYGVKEDKSEQEKELLQVLMPLKELNGVNVTIVQDEAGRAIF
RARIHINEKELNKSAKDVVTALREGEIAIYTRDYGVRQGFFDIDPRPLQGDDIHVIEEKL
REIVGGN
Download sequence
Identical sequences A0A1Y5ZTR7 A0A229MVG8 A0A243I8Q7 A0A2K1RU43 B7HTV7 J8DSR2
WP_000542376.1.101843 WP_000542376.1.13299 WP_000542376.1.16199 WP_000542376.1.17899 WP_000542376.1.18840 WP_000542376.1.24377 WP_000542376.1.24709 WP_000542376.1.26499 WP_000542376.1.27334 WP_000542376.1.31685 WP_000542376.1.32522 WP_000542376.1.33061 WP_000542376.1.38425 WP_000542376.1.41976 WP_000542376.1.43762 WP_000542376.1.46746 WP_000542376.1.47097 WP_000542376.1.48010 WP_000542376.1.48164 WP_000542376.1.48311 WP_000542376.1.48599 WP_000542376.1.49056 WP_000542376.1.51087 WP_000542376.1.52756 WP_000542376.1.55057 WP_000542376.1.5628 WP_000542376.1.57245 WP_000542376.1.57565 WP_000542376.1.59773 WP_000542376.1.72514 WP_000542376.1.77576 WP_000542376.1.79658 WP_000542376.1.80955 WP_000542376.1.82986 WP_000542376.1.8923 WP_000542376.1.91080 WP_000542376.1.91404 WP_000542376.1.99266 gi|217962336|ref|YP_002340908.1| gi|375286858|ref|YP_005107297.1| 405534.BCAH187_A4987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]