SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217962368|ref|YP_002340940.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217962368|ref|YP_002340940.1|
Domain Number 1 Region: 8-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.45e-119
Family AAT-like 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217962368|ref|YP_002340940.1|
Sequence length 396
Comment hypothetical protein BCAH187_A5045 [Bacillus cereus AH187]
Sequence
MKQFELSRAAESLQPSGIRKFFDLAANMKGVISLGVGEPDFVTPWNVRQACIRSLEQGYT
SYTANAGLLELRQEIAKYLKKQFAVSYDPNDEIIVTVGASQALDVAMRAIINPDDEVLII
EPSFVSYAPLVTLAGGVPVPVATTLENEFKVQPEQIEAAITAKTKAILLCSPNNPTGAML
NKSELEEIAVIVEKYNLIVLSDEIYAELVYDEAYTSFASIKNMREHTILISGFSKGFAMT
GWRLGMIAAPVHFSELMLKIHQYSMMCAPTMSQFAALEALRAGNDEVIRMRDSYKKRRNF
MTTSFNEMGLTCHVPGGAFYVFPSISSTGLSSAEFAEQLLLEEKVAVVPGSVFGESGEGF
IRCSYATSLEQLMEAMKRMERFIENKKRTKHNTFCP
Download sequence
Identical sequences A0A1J9ZB53 A0A1Y5ZJM9 A0A229MEL4 A0A243NKH0 A0A2K1RRC0 B7HTY9 J8H1F9
gi|217962368|ref|YP_002340940.1| 405534.BCAH187_A5045 gi|375286891|ref|YP_005107330.1| WP_000808515.1.100684 WP_000808515.1.10069 WP_000808515.1.100873 WP_000808515.1.101309 WP_000808515.1.101843 WP_000808515.1.11044 WP_000808515.1.13299 WP_000808515.1.16199 WP_000808515.1.17899 WP_000808515.1.18840 WP_000808515.1.24377 WP_000808515.1.26499 WP_000808515.1.27334 WP_000808515.1.31685 WP_000808515.1.32522 WP_000808515.1.33061 WP_000808515.1.38425 WP_000808515.1.41976 WP_000808515.1.43533 WP_000808515.1.43762 WP_000808515.1.46244 WP_000808515.1.46746 WP_000808515.1.46864 WP_000808515.1.47097 WP_000808515.1.47441 WP_000808515.1.48010 WP_000808515.1.48164 WP_000808515.1.48311 WP_000808515.1.48599 WP_000808515.1.51087 WP_000808515.1.52756 WP_000808515.1.55057 WP_000808515.1.5628 WP_000808515.1.57565 WP_000808515.1.58328 WP_000808515.1.59773 WP_000808515.1.6753 WP_000808515.1.72514 WP_000808515.1.77576 WP_000808515.1.79252 WP_000808515.1.79658 WP_000808515.1.79687 WP_000808515.1.80955 WP_000808515.1.82421 WP_000808515.1.82986 WP_000808515.1.83070 WP_000808515.1.8450 WP_000808515.1.87627 WP_000808515.1.8923 WP_000808515.1.91404 WP_000808515.1.99266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]