SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217962373|ref|YP_002340945.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217962373|ref|YP_002340945.1|
Domain Number 1 Region: 1-381
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.34e-98
Family Cystathionine synthase-like 0.00000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217962373|ref|YP_002340945.1|
Sequence length 383
Comment class I and II aminotransferase [Bacillus cereus AH187]
Sequence
MQLFHKAVNRRGTHSTKWDTYKNEELIHAWIADMDFEVPQPIQAALKKRIEHPIFGYTLP
PENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFF
EMVTTNNRQLCVSPLQKQNDTYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWTKEELTK
LGSLCTKYNVIVVADEIHSDIIYANHTHTPFASLSEELAARTITCMAPSKTFNIAGLQAS
IIIIPNEKLRQAFTSIQYRQGFHGLNTFAYTAMVSAYTECNDWLNEIRLYIEDNAQFACK
YMKDHIPTLSVTKPEGSFLLWIDCSRLQLSQNERTKLLEEKGKIIVEPGEKYGLGGEEHI
RINIGCPRSVLEEILNRLRHTFS
Download sequence
Identical sequences A0A1Y5ZFS4 A0A229MDF6 A0A243I9Q8 A0A243NKI0 B7HUP9 C2SAR1 J8IW47
gi|375286896|ref|YP_005107335.1| WP_001175834.1.100684 WP_001175834.1.10069 WP_001175834.1.101309 WP_001175834.1.11044 WP_001175834.1.13299 WP_001175834.1.18840 WP_001175834.1.24377 WP_001175834.1.24709 WP_001175834.1.26499 WP_001175834.1.27334 WP_001175834.1.31685 WP_001175834.1.32522 WP_001175834.1.33061 WP_001175834.1.43762 WP_001175834.1.46244 WP_001175834.1.46746 WP_001175834.1.46864 WP_001175834.1.47097 WP_001175834.1.47441 WP_001175834.1.48164 WP_001175834.1.48311 WP_001175834.1.48599 WP_001175834.1.51087 WP_001175834.1.52756 WP_001175834.1.55057 WP_001175834.1.58037 WP_001175834.1.59773 WP_001175834.1.6753 WP_001175834.1.77576 WP_001175834.1.79250 WP_001175834.1.79658 WP_001175834.1.82986 WP_001175834.1.8450 WP_001175834.1.8923 WP_001175834.1.91404 WP_001175834.1.99266 405534.BCAH187_A5050 gi|217962373|ref|YP_002340945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]