SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217962444|ref|YP_002341016.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217962444|ref|YP_002341016.1|
Domain Number 1 Region: 2-398
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.39e-134
Family Cystathionine synthase-like 0.00000000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217962444|ref|YP_002341016.1|
Sequence length 406
Comment cysteine desulfurase SufS [Bacillus cereus AH187]
Sequence
MNIHEIRKQFPILDQKVNGKQLVYFDSAATSQKPIQVIETLERYYKEYNSNVHRGVHTLG
TKATDAYEGAREKVRKFINAKSMEEIIFTRGTTTALNTVAASYGLENVKEGDEIVISYME
HHSNIIPWQQVAKKTGATLKYLPLQPDGTISLEDVRQTVTPNTKIVSIMYVSNVLGTINP
VKEIGAIAHENGAIMVVDGAQSTPHMKVDVQDLNCDFYALSAHKMCGPTGIGVLYGKKEL
LNNMEPIEFGGEMIDFVDLQESTWKELPWKFEAGTPIIGNAIGLGAAIDFLEEIGLDNIE
KHEHELAQYALERLSEVDGVTIYGPKHRAGLVTFNIEDVHPHDVATVLDVEGIAVRAGHH
CAQPLMKWLKASSTARASFYLYNTKEEIDTFVESLIKTKEYFTNVI
Download sequence
Identical sequences A0A1Y5ZJR7 A0A229MD66 B7HUX0 C2SAY4
gi|375286970|ref|YP_005107409.1| WP_001020770.1.13299 WP_001020770.1.18840 WP_001020770.1.24377 WP_001020770.1.26499 WP_001020770.1.27334 WP_001020770.1.31685 WP_001020770.1.32522 WP_001020770.1.33061 WP_001020770.1.43762 WP_001020770.1.46746 WP_001020770.1.47097 WP_001020770.1.48311 WP_001020770.1.48599 WP_001020770.1.51087 WP_001020770.1.52756 WP_001020770.1.55057 WP_001020770.1.59773 WP_001020770.1.72514 WP_001020770.1.79658 WP_001020770.1.82986 WP_001020770.1.8923 WP_001020770.1.91404 gi|217962444|ref|YP_002341016.1| 405534.BCAH187_A5121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]