SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217962805|ref|YP_002341383.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217962805|ref|YP_002341383.1|
Domain Number 1 Region: 2-411
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.21e-184
Family GABA-aminotransferase-like 0.0000000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217962805|ref|YP_002341383.1|
Sequence length 413
Comment serine hydroxymethyltransferase [Bacillus cereus AH187]
Sequence
MDHLKRQDEKVFAAIEAELGRQRSKIELIASENFVSEAVMEAQGSVLTNKYAEGYPGKRY
YGGCEHVDVVEDIARDRVKEIFGAEHVNVQPHSGAQANMAVYFTILEQGDTVLGMNLSHG
GHLTHGSPVNFSGVQYNFVEYGVDAESHRINYDDVLAKAKEHKPKLIVAGASAYPRVIDF
KRFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPHAHFVTTTTHKTLRGPRGGMILCEE
QFAKQIDKSIFPGIQGGPLMHVIAAKAVAFGEALQDDFKTYAQNIINNANRLAEGLQKEG
LTLVSGGTDNHLILIDVRNLEITGKVAEHVLDEVGITVNKNTIPFETASPFVTSGVRIGT
AAVTSRGFGLEEMDEIASLIAYTLKNHENEAALEEARKRVEALTSKFPMYPNL
Download sequence
Identical sequences A0A0G8CBA1 A0A1J9ZPY1 B7HY76 C2MTK7 C2SBY9 J8GMA3 J8IHV5
405534.BCAH187_A5494 WP_000349817.1.101843 WP_000349817.1.13299 WP_000349817.1.5628 gi|217962805|ref|YP_002341383.1| gi|375287340|ref|YP_005107779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]