SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217962896|ref|YP_002341474.1| from Bacillus cereus AH187

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217962896|ref|YP_002341474.1|
Domain Number 1 Region: 24-227,259-422
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.2e-111
Family Cystathionine synthase-like 0.0000000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217962896|ref|YP_002341474.1|
Sequence length 432
Comment O-acetylhomoserine aminocarboxypropyltransferase [Bacillus cereus AH187]
Sequence
MGESWGKGTICVQGGYTPKNGEPRVLPLYQSTTYKYDTSDDLAALFNLEAEGYIYTRIGN
PTLAAFEQKLADLEGGVGAVATASGQAAIMLAVLNICSSGDHLLCSSTVYGGTFNLFGVS
LRKLGIDVTFFNPNLTADEIVALANDKTKLVYAESLGNPAMNVLNFKELSDAAKELEVPF
IVDNTLATPYLCQAFEHGANIIVHSTTKYIDGHASSLGGIVIDGGNFDWTNGKYPELVEP
DPSYHGVSYVQNFGAAAYIVKARVQLLRDYGNCMSPFNAYISNIGLETLHLRMERHSENA
LAVAKWLADHERIEWVNYPGLNSNENYSLAQKYLKKGASGVLTFGIKGGLEAAKEFISNV
KLATLVTHVADARTCVIHPASTTHRQLSAEDQRLAGVTSDLIRLSVGIEDVSDIIADLEA
ALVGGKQHADHN
Download sequence
Identical sequences A0A0T8VN21 A0A1Y5Z4N6 A0A229MG37 A0A243NP93 A0A2K1RWP7 B7HYG7 B9ISW0 C2SC80
361100.BCQ_5248 405534.BCAH187_A5585 gi|217962896|ref|YP_002341474.1| gi|375287428|ref|YP_005107867.1| WP_000504757.1.100684 WP_000504757.1.10069 WP_000504757.1.10762 WP_000504757.1.12751 WP_000504757.1.13024 WP_000504757.1.13299 WP_000504757.1.17408 WP_000504757.1.18840 WP_000504757.1.20687 WP_000504757.1.24184 WP_000504757.1.24377 WP_000504757.1.26499 WP_000504757.1.27334 WP_000504757.1.29209 WP_000504757.1.31685 WP_000504757.1.32522 WP_000504757.1.33045 WP_000504757.1.33061 WP_000504757.1.3318 WP_000504757.1.3615 WP_000504757.1.37093 WP_000504757.1.37990 WP_000504757.1.43762 WP_000504757.1.44463 WP_000504757.1.46746 WP_000504757.1.46864 WP_000504757.1.47097 WP_000504757.1.48164 WP_000504757.1.48311 WP_000504757.1.48599 WP_000504757.1.49428 WP_000504757.1.50316 WP_000504757.1.50514 WP_000504757.1.51087 WP_000504757.1.52756 WP_000504757.1.54775 WP_000504757.1.54782 WP_000504757.1.55057 WP_000504757.1.56055 WP_000504757.1.57203 WP_000504757.1.57815 WP_000504757.1.57859 WP_000504757.1.58814 WP_000504757.1.59773 WP_000504757.1.60274 WP_000504757.1.64377 WP_000504757.1.6753 WP_000504757.1.70645 WP_000504757.1.72514 WP_000504757.1.77576 WP_000504757.1.77690 WP_000504757.1.79658 WP_000504757.1.81088 WP_000504757.1.82533 WP_000504757.1.82986 WP_000504757.1.83070 WP_000504757.1.84337 WP_000504757.1.8450 WP_000504757.1.87627 WP_000504757.1.8923 WP_000504757.1.91404 WP_000504757.1.91615 WP_000504757.1.93932 WP_000504757.1.95457 WP_000504757.1.95484 WP_000504757.1.99266 gi|222098879|ref|YP_002532937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]