SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325962159|ref|YP_004240065.1| from Arthrobacter phenanthrenivorans Sphe3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325962159|ref|YP_004240065.1|
Domain Number 1 Region: 8-176
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.67e-32
Family Phosphoglucomutase, first 3 domains 0.00034
Further Details:      
 
Domain Number 2 Region: 164-271
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.92e-29
Family Phosphoglucomutase, first 3 domains 0.0000912
Further Details:      
 
Domain Number 3 Region: 288-384
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.41e-25
Family Phosphoglucomutase, first 3 domains 0.00097
Further Details:      
 
Domain Number 4 Region: 387-471
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 2.75e-20
Family Phosphoglucomutase, C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325962159|ref|YP_004240065.1|
Sequence length 472
Comment phosphomannomutase [Arthrobacter phenanthrenivorans Sphe3]
Sequence
MTSEQTATFDLSASFKAYDVRGIVGESITAEIVEAVGAAFVDILELQGQTILVGGDMRPS
SPEFSKAFANGATTRGANVELLDLISTDELYFACGYLNRAGATFTASHNPAGYNGIKMSK
AGAVPISSESGLKDIQTLAERYLTEGSIPAAGTRGTISVRDVLKDYSEYLRKLVDLSGSR
PLKVVVDAGNGMAGLTTPAVLGDTLLPKLPLDIIPLYFELDGSFPNHPANPLEPENLRDL
QAAVIEHGADIGLAFDGDADRCFVVDEKGEPVSPSAITGMVARREIARAKAQGEARPTII
HNLLTSRAVAELVERDGGRAVKTRVGHSFIKAVMAEEGAVFGGEHSAHFYFRDFWNADTG
MLAAMHVLAALGEQDGPLSELGREYEPYVSSGEINSEVEDKPAAVERVRAAFAGEDITID
TMDGSTFTANDGSYWFNLRPSNTEPFLRLNAEATDRATMERIRDRVLSIVRG
Download sequence
Identical sequences F0M148
gi|325962159|ref|YP_004240065.1| WP_013599873.1.14739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]