SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325962670|ref|YP_004240576.1| from Arthrobacter phenanthrenivorans Sphe3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325962670|ref|YP_004240576.1|
Domain Number 1 Region: 48-207
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.06e-38
Family Phosphoglucomutase, first 3 domains 0.0012
Further Details:      
 
Domain Number 2 Region: 323-350,379-472
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.71e-27
Family Phosphoglucomutase, first 3 domains 0.0034
Further Details:      
 
Domain Number 3 Region: 246-334
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.2e-21
Family Phosphoglucomutase, first 3 domains 0.0028
Further Details:      
 
Domain Number 4 Region: 474-576
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000011
Family Phosphoglucomutase, C-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325962670|ref|YP_004240576.1|
Sequence length 588
Comment phosphomannomutase [Arthrobacter phenanthrenivorans Sphe3]
Sequence
MPMTSSDADFRLLTEAREWAAKDPDPVTSASLLELVRLVEEGAPAARQELEDSFRGTLQF
GTAGLRAALGPGPNRMNRVVVRRAAAGLADFLRSAVGEASPGTRPRAVVGYDARHNSDVF
AQETAAIFTAAGIETFLMPSALPTPVLAYAVRALECDGGVMVTASHNPPQDNGYKVYLGR
HAVPDSGNGAQIVTPFDADIAARINAAGPIETISLARDGWTVLDGSLAAGYEAAVAALAL
PEHFPARDLRIVLTPLHGVGGETALGVLKAAGFKDITLVAEQADPDPDFPTVSFPNPEEP
GALDLALQAAEQHAADIVIANDPDADRAAVAAKDPDTGAWRMLRGDEVGALLGAHVAARR
AAGRGADDGGAEESATGVFASSIVSSRLLARIAAAAGYAHQETLTGFKWISRVPGLVYGY
EEALGYCVAPDLVRDKDGISAALLIAELAAAAKAEGKTVFDTLDELYLQHGLHASDQLSI
RVADLGLLDAMMNRLRVSPPETFGSSSVEVYTDLAEGTDQLPPTDGLLYVTRDLTRVIIR
PSGTEPKLKCYLEVIHQVGSAAELPAARQSVRAALDEVLRDVSEALGL
Download sequence
Identical sequences F0M5R2
WP_013600381.1.14739 gi|325962670|ref|YP_004240576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]