SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325961464|ref|YP_004239370.1| from Arthrobacter phenanthrenivorans Sphe3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325961464|ref|YP_004239370.1|
Domain Number 1 Region: 76-265
Classification Level Classification E-value
Superfamily Rhomboid-like 1.03e-41
Family Rhomboid-like 0.0016
Further Details:      
 
Domain Number 2 Region: 9-43
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000252
Family B-box zinc-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325961464|ref|YP_004239370.1|
Sequence length 291
Comment hypothetical protein Asphe3_00160 [Arthrobacter phenanthrenivorans Sphe3]
Sequence
MSYGIPSAEPSAQVPVCPRHPDRPSYVRCQRCGRPACPDCQRAAAVGFQCVDCVNEAQRT
TPEVRTVYGGAVATGKPMVTFGIIAACAVLYVLQWVIPSDAVFRNLAFASVYATPEYGAF
EPWRMLTAAFLHSQGFILHIVLNMYMLWIFGQALEPLLGRVRFLAVYLLSAIGGSVGYLA
LTPILPPGGPVGVVGASGAIFGLFGAMLLVQRQRGGDTRQLWVLIAINGVIGFLIPQIAW
QAHLGGLITGALCAAVVAYAPRGRRQGLLQAAGLLAVLVLLIAVSWVRVSL
Download sequence
Identical sequences F0M4P1
gi|325961464|ref|YP_004239370.1| WP_013599180.1.14739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]