SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325961726|ref|YP_004239632.1| from Arthrobacter phenanthrenivorans Sphe3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325961726|ref|YP_004239632.1|
Domain Number 1 Region: 8-380
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.48e-66
Family TK-like PP module 0.067
Further Details:      
 
Domain Number 2 Region: 387-601
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.41e-25
Family TK-like Pyr module 0.081
Further Details:      
 
Domain Number 3 Region: 624-742
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000129
Family Transketolase C-terminal domain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325961726|ref|YP_004239632.1|
Sequence length 798
Comment phosphoketolase [Arthrobacter phenanthrenivorans Sphe3]
Sequence
MTGSMGQDELELVDRWWRAANYLSVGQIYLRSNALLREPLKPEHTKSRLLGHWGTTPGLN
FVYAHLNRAIRRDSAEMLFVAGPGHGGPAVVANAWLEGTYSEIYGHVGNDGDGMAELFRQ
FSYPGGIPSHAAPESPGSINEGGELGYSLAHAYGAVLDNPQVVAAVVIGDGEAETGPLAA
SWHSHNFLDPATDGAVLPILHLNGYKIANPTVLARMPEAQLEQLLRGYGHEPYFVTVKDP
DNTEQAHQDFAAALDGCLADIRAIQDSRRTPQGGQDVLDVAGQSAEAPRWPMIVLRSPKG
WTGPRYVDGLQVEGTWRSHQVPLSEVRTNGEHLAQLEEWLRGYRPEELFDGDGRLRPDVA
EAAPTGSFRMSATPHANGGLLRKALKLPAYGDHAVEVARAGTERISPMITLGSWMRDVIS
LNMETFRLFGPDETASNRLQNVYEVTDKVWQYRIDDADEHLARSGRVMEVLSEHLCQGWL
EGYLLTGRHGVFSCYEAFIHIVDSMFNQHAKWLKVHRQLPWRQPVASLNYLLSSHVWQQD
HNGFSHQDPGFIDHAVNKKAEVIRVYLPPDANTLLYIMQHCLASTDYVNIVVSGKQPSPT
WLGPEDAANHCRRGLGIWPFAGSEVPGEEPDVVLACAGDVPTVETVAAAELLREGVPGLK
VRVVNVVDLMRLQDESEHPHGLPSRDFDGIFTNDKPIIFAYHGYPALIHRLAYRRSNQEG
LHVRGYKEEGTTTTPFDMAMLNGIDRFQLAIDAIDRVPGLAEKHSLVRQELQDRRMRARQ
HTRIHGEDPEEIRNWKLG
Download sequence
Identical sequences F0M7U5
gi|325961726|ref|YP_004239632.1| WP_013599440.1.14739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]