SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325965071|ref|YP_004242977.1| from Arthrobacter phenanthrenivorans Sphe3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325965071|ref|YP_004242977.1|
Domain Number 1 Region: 458-714
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000327
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 2 Region: 158-418
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000451
Family Tropomyosin 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|325965071|ref|YP_004242977.1|
Domain Number - Region: 695-765
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325965071|ref|YP_004242977.1|
Sequence length 779
Comment hypothetical protein Asphe3_37470 [Arthrobacter phenanthrenivorans Sphe3]
Sequence
MRTSSSTSVRTRRLAAAVVLPGLLATSLVLVQPASAGTSTSTGICSGVVNQFAHRGTVQE
NLLKAAAKKNADVIAGLQAERDSLQAQEAALTLDIAAAVQAIADIEKEEKQYESDLQAAT
DEAARVAADQAAIEAEIAGAEARLADLQDEQLRVEGELAPLEEELAAAQAIAVDLRDSVT
ALVAEQEANTQAMTVARDELESLQQAAADAAGAVAAKETEIRNAQDELIVLAAEAESASS
AVTAAELEAAKAEEELKTLEAAGTIAEGALQAQKDKVADAQQTLLDLQAKAADAAGAISA
KQAQMDIGRQELEGLQATAENAAEALADKNAALTAAQADLQKLEGEAAGAAKALDDNTAS
IAALTAGIAELQGQISTLESQAATKQAELAAAQAELPALQAEKTALEAEIARLNLEIAKF
PVNSNSTAKRQLEAARLAKQAELEGVLTEIADKNALISALEGDLDTLNKQVAALNTQLLA
KQQESSSLQTQAAGLQAALDAANAAVTAKQGDIEALESQVPVLQGAVDQANAAVANKQFE
LDSLEDELPALQDAAVAAADAVVDQQKVLDELTAALPGLESDFQQAQLAIMEQQAVVDGK
KWELLQADAARSAANTAVEEKQGEIAALLGQLPELQKSLDVANQAVSDLSGEIARLNQLA
DSLVDKLTGLNSQITAKEAEILSLQNRVAPLVAELDRLNGEVSAAEAHLAGLQSQLQGLD
TQLTAAQEKLRDLQAQKKPAKSLVEAQRLTVSDLQAQLGSVQQQIAAIDPSIRNGGCAV
Download sequence
Identical sequences F0M7R4
gi|325965071|ref|YP_004242977.1| WP_013602728.1.14739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]