SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428320546|ref|YP_007118428.1| from Oscillatoria nigro-viridis PCC 7112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428320546|ref|YP_007118428.1|
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily RbcX-like 4.32e-44
Family RbcX-like 0.00000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428320546|ref|YP_007118428.1|
Sequence length 136
Comment chaperonin family protein RbcX [Oscillatoria nigro-viridis PCC 7112]
Sequence
MDLKQVAKDTAKVLASYLTYQSVRMVVAQLSETNPPLAIWLNDFSSKGKIQDGEAYIQEL
LLENQDLGFRIMTVREYLAHDVVEFLPEMVRTNIQQANMEHRRQHLERITQLNWSLPSSN
PESSIDSEPNLDNLSS
Download sequence
Identical sequences K9VR84
WP_015179213.1.100662 gi|428320546|ref|YP_007118428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]