SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337739047|ref|YP_004634406.1| from Oligotropha carboxidovorans OM5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337739047|ref|YP_004634406.1|
Domain Number 1 Region: 526-545,586-829
Classification Level Classification E-value
Superfamily HAD-like 2e-47
Family Meta-cation ATPase, catalytic domain P 0.00041
Further Details:      
 
Domain Number 2 Region: 314-427
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.02e-25
Family Calcium ATPase, transduction domain A 0.003
Further Details:      
 
Domain Number 3 Region: 264-315,428-521
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-17
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 
Weak hits

Sequence:  gi|337739047|ref|YP_004634406.1|
Domain Number - Region: 21-77
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.00109
Family HMA, heavy metal-associated domain 0.0055
Further Details:      
 
Domain Number - Region: 82-148
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0309
Family HMA, heavy metal-associated domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337739047|ref|YP_004634406.1|
Sequence length 840
Comment cadmium (Cd/Co/Hg/Pb/Zn) -transporting ATPase CadA [Oligotropha carboxidovorans OM5]
Sequence
MTEKLRLDIPLLLQGVPDADDACVARLISEVRNREGIEDVHVAAVSAESAQLCVHYDPDI
MSLSRIRQFVTSAGARITERFGHVLWQVEGISHQRRARTVADRVRALPGVREAQASATGL
LRVEFDRVERGSEEAIRDTLAGMGLTVTEPVGRPAAKSDHVHKHQVADAHAGHDHDEHGH
AHVRKDGGHAHTHGGLFGPNTELIFALACGALLAVGFGVEKLAPTAPGWLPLSCYIAAYF
FGGFYTLREAIDNLRLGKFEIDTLMLVAAAGAAALGAFAEGALLLFLFSLGHALEHYAMG
RAKQAIEALAELAPRTATVRRNEQSREVPVEELVVADVVIVRPNERLPADGFLIKGETSV
NQAPVTGESIPVDKHPVEDIAMARAKPNSVDASSRVFAGTINGAGAIEVEVTRLSTETAL
AKVVQMVSEAETQKSPTQRFTDKFERYFVPAVLTLAFVLLFAWAVIDEPFRASFYRAMAV
LVAASPCALAIATPSAVLSGVARAARGGVLVKGGAPLENLGSLSAIAFDKTGTLTEGRPR
ITDVVPAEGVSEEELLRVAVAVEQLSDHPLAAAIARDGRERLGGTAVAEAQNLKNLIGRG
VTATLDGRPVWIGKAEMFGVDGIAPLGEESTAAIAKLRDGGRTTMVVRQGDKELGAIGLM
DTPRAAARDALAKLHALGIKRMIMISGDHQKVAEAIAKDVGLDEAWGDLMPEDKVEAIKK
LRAEQKVAMVGDGVNDAPAMASATVGIAMGAAGSDVALETADVALMADDLSHLPFAVGLS
RHTRGVILQNVFISLGVVALLVPATVFGLGIGPAVAMHEGSTLVVVFNALRLLAYRDSRG
Download sequence
Identical sequences B6JK76
WP_012564844.1.10663 WP_012564844.1.50963 WP_012564844.1.53695 gi|337739047|ref|YP_004634406.1| gi|337739047|ref|YP_004634406.1| gi|386031896|ref|YP_005952418.1| gi|337739047|ref|YP_004634406.1|NC_015685 gi|386031896|ref|YP_005952418.1|NC_017539 504832.OCAR_7723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]