SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|68536118|ref|YP_250823.1| from Corynebacterium jeikeium K411

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68536118|ref|YP_250823.1|
Domain Number 1 Region: 114-295,419-589
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000829
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 5.07e-36
Family GAD domain 0.00053
Further Details:      
 
Domain Number 3 Region: 2-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.1e-29
Family Anticodon-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|68536118|ref|YP_250823.1|
Sequence length 600
Comment aspartyl-tRNA synthetase [Corynebacterium jeikeium K411]
Sequence
MLRTHLAGELRPDNIGDEVTLTGWVGRRRDHGGVIFIDLRDRSGVAQVVFRESEVAERAH
DLRSEYCLKVTGVVEARPEGSENPNLASGGIEVNVSALEVLNEAAALPFQIDDPSTSGEV
GEETRLKYRYLDLRRKTQGDALRLRSRVNQAARGVLAEHDFTEIETPTLTRSTPEGARDF
LVPARLRPGTFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDVEM
SFVDQEDVISLAEEILVAIWKEIGYEISTPIPRMTYADAMKYYGSDKPDLRFDIQITECT
DFFKNTTFRVFQNEYVGAVVMEGGADQPRRQLDAWQEWAKQRGAKGLAYILVGEDGELSG
PVAKNITDEERAGIAEHVGAKPGDCIFFAAGETKPSRALLGAARGEIANKLGLIKEGDWA
FTWVVDAPLFEPAADATASGDVALGHSAWTAVHHAFTSPKPEYLDNFDENPGEALAYAYD
IVCNGNEIGGGSIRIHQPDVQERVFKVMGITEEEAREKFGFLLDAFAFGAPPHGGIAFGW
DRIVSLLGGFDSIRDVIAFPKSGGGVDPLTDAPGEISAAQRKESGIDFKPKKGPQGQKEK
Download sequence
Identical sequences Q4JVF2
gi|68536118|ref|YP_250823.1| 306537.jk1041 WP_011273608.1.58937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]