SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|68536421|ref|YP_251126.1| from Corynebacterium jeikeium K411

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68536421|ref|YP_251126.1|
Domain Number 1 Region: 2-319
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.7e-79
Family ATP synthase (F1-ATPase), gamma subunit 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|68536421|ref|YP_251126.1|
Sequence length 326
Comment ATP synthase F0F1 subunit gamma [Corynebacterium jeikeium K411]
Sequence
MASLRELRTRIKSVNSTKKITKAQELIATSRITKAQARVDDAEPYADEITRVVQRLAAAS
TLDHKILQEPTDASRAAILVVSSDRGMCGGYNNNVFKKTAELRKRLENEGKDVVLYVSGN
KGISYYNFRGEDIAGAWSGYSQDPDYAATHDVRRHLIDGFVAGSEGTAKWREGLKAEEGQ
AVQGFDEVHIVYTRFESMLSQKPEAHRLLPIETVVEEEKFELGEDLVSDKVDHIAADYDF
EPDPDTLLKALLPQYVSRGIFAAMLESAASESAARRTAMSAATDNATDLVKQLSRVANQA
RQAQITQEITEIVGGASALADSGESD
Download sequence
Identical sequences A0A1V3DNW6 Q4JUJ9
306537.jk1336 WP_005292974.1.55873 WP_005292974.1.56325 WP_005292974.1.58937 WP_005292974.1.71728 gi|68536421|ref|YP_251126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]