SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|68537089|ref|YP_251794.1| from Corynebacterium jeikeium K411

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68537089|ref|YP_251794.1|
Domain Number 1 Region: 30-414,444-540
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 6.54e-179
Family Heme-dependent catalases 0.000000000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|68537089|ref|YP_251794.1|
Sequence length 543
Comment hypothetical protein jk1994 [Corynebacterium jeikeium K411]
Sequence
MTATNNDGTNNDPITTAKGVASRGVCPYSGASTNVNGSPVSTEEHSATVGQQGPLLLSDV
HLVEKHAHFNRERIPERNVHAKGSGAFGELTITEDVSKYTKADLFQPGRVTPMLARFSTV
AGEQGFPDAVRDVRGFSLKFYTQQGNYDIVGNNTPVFFLRDGIKFPDFIRSQKRLADSGL
RSADMQWDFWTRSPETAHQVTYLMGDRGIPTDFRHMDGFGSHTYQWINDAGERFWVKYHF
KTRQGWDFYTEEEAAKVIASGNFDSSRQDLYDAIERGDYPTWDVKVQIMPVAEAEDYRWN
PFDLTKTWSQKDYPLIPVGHFTLNENPQNFFAQIEQAAFAPSNLVPGIGLSPDKMLLARS
FAYADTQRYRLGVNFHQLPSNRSIVAEKNYYTAKDGAGNQEFPPAGTPVYSPNRFERGEG
VNDVNDGSGAVEQGVAAGESQYGFGRGQESAVTAAEELGLFDDLHGTDLTRGAYVRHPED
DDFIQAGQLVREVLDDAARERLANNIAGAMDGVSDQVAEQCWTYWGKVDENLRDRVKEIF
TGK
Download sequence
Identical sequences A0A1V3DPI5 Q4JSN1
gi|68537089|ref|YP_251794.1| WP_005292312.1.55873 WP_005292312.1.58937 WP_005292312.1.71728 306537.jk1994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]