SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328954643|ref|YP_004371976.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328954643|ref|YP_004371976.1|
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.06e-24
Family DNA-binding N-terminal domain of transcription activators 0.0012
Further Details:      
 
Domain Number 2 Region: 118-271
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000000191
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328954643|ref|YP_004371976.1|
Sequence length 273
Comment MerR family transcriptional regulator [Coriobacterium glomerans PW2]
Sequence
MFRIGEFSKLAEVSIRMLRYYDAIGILKPAEVDKWTGHRLYSVEQIPRLNKILYLRDSGF
NVDEIAHVLDMDDYLLLEHLERKRSEINRVIQGEQKKLKKIAIAKDEIQCNKSELHYNIS
IKSIPGQKVLSLRKIVPTYHSEGDLWNEISAFAKDKKIKISNNTFSIYHDTEYKERDVDI
ELCAPVNTLQKNTPMPSSFCFRITEPIQTMASTMVYGDFSNISGAYIAFSKWLQKNSQYR
MLNPMRQIVHRGPWNENDSLKFLIEIQIPLELE
Download sequence
Identical sequences F2N6W2
gi|328954643|ref|YP_004371976.1| WP_013707904.1.79872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]