SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328954894|ref|YP_004372227.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328954894|ref|YP_004372227.1|
Domain Number 1 Region: 6-199
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.09e-51
Family Class I glutamine amidotransferases (GAT) 0.0000136
Further Details:      
 
Domain Number 2 Region: 186-407
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.09e-47
Family N-type ATP pyrophosphatases 0.00000212
Further Details:      
 
Domain Number 3 Region: 395-526
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.7e-45
Family GMP synthetase C-terminal dimerisation domain 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328954894|ref|YP_004372227.1|
Sequence length 526
Comment GMP synthase [Coriobacterium glomerans PW2]
Sequence
MAASQKVLVLDFGAQYGQLIARRVRDLHVYSEIVAGDSPAADIEAMEPSALILSGGPASV
YAEDAPEIDPAIFELGVPVLGFCYGHQIMASTLGGQVAHVEVGEYGPASIERERESRLLN
ATPLKQTVWMSHRDAVSSAPAGFTVTSSTEACPVASMEDHQRRLYSTQFHPEVRHTECGE
QILSNFLFDICGLEPSWTMESIVEAKVAEIRERVGDARVILALSGGVDSSVVAALCARAI
GPRLTCVFINHGLLRKNEPEQVEEIFSSQFDVDFVHVHAEERYAALLAGVVDPEEKRRII
GTQFWEEFFAVAQRTGGVRFLAQGTIYPDIIESGARKTGGRAATIKSHHNLIPFPEGVSF
DLIEPLDHFFKDEVRELGLQLGLPGHIVYRQPFPGPGLAIRIIGAVDAEKLAILKDADAI
VREELDAYNERLFRQTGERNSAHSCWQYFAVLPDIRSVGVMGDERTYGRPVILRAVESTD
AMTADWARLPYDVLAHISSRIVAEVGGVNRVAYDITSKPPATIEWE
Download sequence
Identical sequences F2NA18
gi|328954894|ref|YP_004372227.1| WP_013708155.1.79872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]