SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328955080|ref|YP_004372413.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328955080|ref|YP_004372413.1|
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 3.92e-25
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328955080|ref|YP_004372413.1|
Sequence length 153
Comment PTS transporter subunit IIA-like nitrogen-regulatory protein PtsN [Coriobacterium glomerans PW2]
Sequence
MLLKEIYDRGHYAFTAGPLSWREAIRACCAPLMADGTIEPIYAEEIIACVEKHGPYIVLI
PGVAMPHSTENATGCNATAIGFMRCSEPVSFEQGNPERDAQIFFTLCDTDQETHFANMAK
LYSILTDDAVVAKLKLATRAQDLLEIDKLVQGG
Download sequence
Identical sequences F2N7C3
WP_013708341.1.79872 gi|328955080|ref|YP_004372413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]