SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328955082|ref|YP_004372415.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328955082|ref|YP_004372415.1|
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.00000000000000152
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328955082|ref|YP_004372415.1|
Sequence length 102
Comment L-Asc family PTS system transporter subunit IIB [Coriobacterium glomerans PW2]
Sequence
MNAKILVACANGAGTSLMMKMTVERVTKRLGMAVADIHHCALSEAVSSARQFDIVFAPLN
FKDMYSEAESAGVCVIGLRNVLSDAEVEKHLVECGQVEKFKA
Download sequence
Identical sequences F2N7C5
WP_013708343.1.79872 gi|328955082|ref|YP_004372415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]