SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328955161|ref|YP_004372494.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328955161|ref|YP_004372494.1|
Domain Number 1 Region: 387-476
Classification Level Classification E-value
Superfamily PTS system IIB component-like 2.93e-19
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328955161|ref|YP_004372494.1|
Sequence length 491
Comment PTS system D-mannitol-specific transporter subunit IIBC [Coriobacterium glomerans PW2]
Sequence
MNTNHSAKHVSKRARVQAFGGYLTNMVIPNIGAFIAWGIATALFIPTGWLPNQALNELIN
PTIKYLLPLLLAYTGGRMIGGHRGGVLATIGTIGLIIGSDVTMFLGAMIVGPLSGWIMKK
MDAYLEKRIPAGFEMIVNNFSIGIAGFVLMVLSYLIVGPTIQAANNFVKDSIEALVKTGF
LPILSLINEPAKVLFLNNVIDQGVYYPLGMEQTLEAGKSIYFMLASNPGPGLGLLLAYSV
FGKSAARRTAPGAIIIHFLGGIHEMYFPYVLMKPLTIISMILGAMSGIMTFQLFGAGLVA
GPSPGSIFAYMALTPRGNFVGVFAGVIVATIVSFLTTSVILKADSSPNDDAQFEGSVTRS
KDMKLEGINSNEAARSELSSAAATVLRKISFACDAGMGSSAMGATIFRKRLKRAGISCVT
VKHYRIEDIPEDSDVVVVHKDLEERTVATRPSANIVALDSYLEDPKIDELLREVVRANRD
GDDADELRVRQ
Download sequence
Identical sequences F2NBE3
WP_013708422.1.79872 gi|328955161|ref|YP_004372494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]