SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328955642|ref|YP_004372975.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328955642|ref|YP_004372975.1|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily RNase III domain-like 2.27e-38
Family RNase III catalytic domain-like 0.00068
Further Details:      
 
Domain Number 2 Region: 116-229
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 8.49e-23
Family Double-stranded RNA-binding domain (dsRBD) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328955642|ref|YP_004372975.1|
Sequence length 241
Comment RNAse III [Coriobacterium glomerans PW2]
Sequence
MQVSEKLRAAEQICHHRFADRQLLRCALTHPSAVEGQPVCASYERLEFLGDSILGAIVAV
ALFNSYPSIDEGRLTRLKVSLVSGAMLSDVGLELGIDRCIIFGASETGTGARGMHSALEN
VYESLVAAMYLDGGWDVAEAFILRTLEPHLADDRPESVSNPKSILQERVQEDHGEPPCYK
LVGMSGPAHEPTFTAVVLVDGVRCGRGTGSSKKEAEASAARDALERMGCSHQGVSSNEKL
G
Download sequence
Identical sequences F2N9Q7
gi|328955642|ref|YP_004372975.1| WP_013708903.1.79872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]