SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328955761|ref|YP_004373094.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328955761|ref|YP_004373094.1|
Domain Number 1 Region: 513-651
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 4.19e-23
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0052
Further Details:      
 
Domain Number 2 Region: 304-407
Classification Level Classification E-value
Superfamily PTS-regulatory domain, PRD 6.93e-18
Family PTS-regulatory domain, PRD 0.0036
Further Details:      
 
Weak hits

Sequence:  gi|328955761|ref|YP_004373094.1|
Domain Number - Region: 187-223
Classification Level Classification E-value
Superfamily PTS-regulatory domain, PRD 0.000746
Family PTS-regulatory domain, PRD 0.013
Further Details:      
 
Domain Number - Region: 1-43
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00843
Family Z-DNA binding domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328955761|ref|YP_004373094.1|
Sequence length 654
Comment transcriptional antiterminator BglG [Coriobacterium glomerans PW2]
Sequence
MLSEREQQLLRALLESAGPLSARALASRLDVSIRTVKACVQKINAKVPGCIGSNRSGYHP
DPDLASALIDAQRSDDVPQNSRERIVFLLRRLLFANRSLNVFDLCEELFVSLTTMKTDLS
RVRHRIAPFRLDLVQHDNQLSLEGLEKDKRRLGSDLLYSETSVNFLDLSTIEQAFPDIDA
GYISACVRETLDEYRRFANDYSVVNLVLHIAITIERIRSGNSLSGMRWIEDDRSVADAGS
VGSRDPESSGAGDRELALAITGRLAEHFGIAFSSVEVYELSLLLASRTTLLDYRTATKDD
IEHFIGSECLALVREMISDLSGYYGIDLSEHEFFVRFALHIKNLLLRAKSGGLSKNPLTQ
QIRSMCPLLYDTAVAEACLIKMRTALEINDDEIAYIAFHLGSALETQKQLTNKVKAVLYC
PSYYDLDKKVMLFLDRHFEAVLLITNIVTEEEDLAHLSAVDLLIATVPVKVYSGAPIYRV
NIFPTDHDAEEIRRIVEELKHRKRRGEIRGNLERLMFAELFEINEDRMTRDEVIHRMVNR
LRARDWVGEDFEERVWEREALSSTSLSSFALPHPVRLCSKRSSISVMVSHTPIDWNGEYV
RLVMMLSFNRRDRAAFYELFDPLVCVLSDPQQVLALSRCENYEEFISRLCDMME
Download sequence
Identical sequences F2N896
gi|328955761|ref|YP_004373094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]