SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328955763|ref|YP_004373096.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328955763|ref|YP_004373096.1|
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.00000000000000162
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328955763|ref|YP_004373096.1|
Sequence length 94
Comment PTS system lactose/cellobiose-specific transporter subunit IIB [Coriobacterium glomerans PW2]
Sequence
MKKIILACGAGVATSTVVAGKISELLDKNGYEGLYSIVQCEIAEAKSQCAGADLLIATTV
APEGIECPYVNGVPFLTGMGRASAERDILAALAG
Download sequence
Identical sequences F2N898
gi|328955763|ref|YP_004373096.1| WP_013709024.1.79872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]