SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328955958|ref|YP_004373291.1| from Coriobacterium glomerans PW2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328955958|ref|YP_004373291.1|
Domain Number 1 Region: 3-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.14e-60
Family G proteins 0.000000174
Further Details:      
 
Domain Number 2 Region: 304-396
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.17e-33
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000094
Further Details:      
 
Domain Number 3 Region: 207-303
Classification Level Classification E-value
Superfamily Translation proteins 1.43e-28
Family Elongation factors 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328955958|ref|YP_004373291.1|
Sequence length 396
Comment translation elongation factor 1A (EF-1A/EF-Tu) [Coriobacterium glomerans PW2]
Sequence
MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLSETPGCKADYTAFENIDKAPEERE
RGITISVAHVEYETQTRHYAHVDCPGHADYIKNMISGAAQMDGAILVIAATDGPMAQTRE
HILLASQVGVDYIVVFLNKCDMVDDEELIDLVEMETRELLSEYDFPGDDIPFIRGSALGA
LNGDEKWKGAIVELMKAVDEYIPTPERDNDKPFLMAVEDVMTISGRGTVATGRVERGELK
LNETVEIVGIRDTQNSVATGIEMFRKSMDFCEAGDNVGILLRGIKREDIERGQVLCKPGS
VHPHTKFTGEVYVLTKEEGGRHTPFFDGYRPQFYFRTTDVTGNVKLPDGVEMAMPGDHVT
ITGELIHPIAMEEGLRFAIREGGHTVGSGVVSTIIE
Download sequence
Identical sequences F2NAM0
WP_013709218.1.79872 gi|328955958|ref|YP_004373291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]