SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332795706|ref|YP_004457206.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332795706|ref|YP_004457206.1|
Domain Number 1 Region: 184-426
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.23e-85
Family Leukotriene A4 hydrolase catalytic domain 0.0013
Further Details:      
 
Domain Number 2 Region: 4-171
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.7e-39
Family Leukotriene A4 hydrolase N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332795706|ref|YP_004457206.1|
Sequence length 780
Comment peptidase M1 membrane alanine aminopeptidase [Acidianus hospitalis W1]
Sequence
MQIDSYDVFIEFNFKGLQYHGIEKIKLSTEDKVVLDAEGVKVTRVRINGKSVDFLSDEKT
VTISTGNFSGIIEVEFEGKVRDDLVGMYIAPYDNSYIFTTQFESSHARKFIPCVDNPSYK
AEFKFTVKVDKDLDVISNMPPQKIYYEGDKKIIEFLKTPKMSTYLIYMGVGKFEEYYDYS
SQPIVIVATVPGKILKAKIPADFARKFIKFYEDYYGIKYQLPKAHFIAIPEFAFGAMENW
GAITFRETALLADENSSVRQLRRVAEVIAHELAHQWFGDLVTLKWWNDLWLNESFATFMS
YKAVNWLHPDWDYWGEFLYSETAGAMEKDSLHITHPIEVEVKKPEEIEQLFDDISYGKGA
SILRMIESYMGEEEFRKGISNYLNKFSFSNAEGKDLWNSLEEASGKPISNIMPSWIVQEG
YPLITVKVKDNIIKFEQRRFMLDGSTDDKIYMVPLTLEVNGNKKISLLLDSKEKEYNVGE
KVNSIKVNLNRAGFYRVYYDDLRILGSMNHLEKFGLINDYFSFLLAGIIPFEEYEKIVQS
MMNEESYLPVLELASQLFKLYAINPKKYSSLALQFHESQEKIWRTKTDALGKLTYSNIIE
NLVQMDYNFALELSKEMANFSSIDPNKKDAVARAYAIVNEDSVFDEILDKYRKEKFDEEK
MTYLKAMLSFKKPYLVSNTLSLSLTGEIKKQDIVRILPIVAYNVEAKEAVWSWLKTYMDN
IRKYYQGTGILGRVLSDVLPILGIGKEKEVEDYFNKHPMPESEKGIRQGIEKLKIFSRLA
Download sequence
Identical sequences F4B3L9
WP_013774825.1.74519 gi|332795706|ref|YP_004457206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]