SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332795707|ref|YP_004457207.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332795707|ref|YP_004457207.1|
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000195
Family Nuclease 0.095
Further Details:      
 
Weak hits

Sequence:  gi|332795707|ref|YP_004457207.1|
Domain Number - Region: 96-159
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0106
Family ABC transporter transmembrane region 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332795707|ref|YP_004457207.1|
Sequence length 232
Comment hypothetical protein Ahos_0014 [Acidianus hospitalis W1]
Sequence
MKIEYAKNIFPKIIELLNRATDEITIATGGFSEDFIEAIINRAASGVQTTIITSDKNWAR
WLENQKISYKKDEENKIRKSYLRLRDKIIIYSRLRYIILIISISIVIVLLIRNVIHSLVT
LISFIIIIIINIIQFIYIRNMIKAEESKLNMLNIEVQKTLDELTSTRNILAKKLNIIESS
ALSFSIVIIDNKSLLLSCNLNSKNSSDIVMYEEIQKNDAIKLISYITNLGKP
Download sequence
Identical sequences F4B3M0
gi|332795707|ref|YP_004457207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]