SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332795936|ref|YP_004457436.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332795936|ref|YP_004457436.1|
Domain Number 1 Region: 16-125
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.0000000000000216
Family Fumarate reductase respiratory complex cytochrome b subunit, FrdC 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332795936|ref|YP_004457436.1|
Sequence length 127
Comment succinate dehydrogenase subunit [Acidianus hospitalis W1]
Sequence
MVYDNNYNIVVLHRALLGDKMRESKLRFWGVYITGIVTLILLSIHFFMLFANNLNFDNRI
STPVVDEYLSNSAYYSLLGLLLVVAFIHGLLGVRRSLYDFGIKKGVKDVKIGGIIILLVL
LFFYFTT
Download sequence
Identical sequences F4B4X3
gi|332795936|ref|YP_004457436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]