SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332796180|ref|YP_004457680.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796180|ref|YP_004457680.1|
Domain Number 1 Region: 185-419
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.66e-69
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000632
Further Details:      
 
Domain Number 2 Region: 9-187
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.12e-62
Family Aminoacid dehydrogenases 0.00000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332796180|ref|YP_004457680.1|
Sequence length 420
Comment glutamate/leucine dehydrogenase [Acidianus hospitalis W1]
Sequence
MTVEEVLSSNLYTQQIKKLYRVGEILGLQDDQLEALATPERVIQVKIQVPSSNGKIKTFT
GWRSQHNSALGPYKGGVRYHPNVTQDEVIALSMIMTWKNSLLQLPYGGGKAGIRVDPKSL
SRTELEILSRNFIDALHKYIGSDLDIPAPDVNTDSQIMAWFLDEYIKVSGKVDLGAFTGK
PVELGGISVREYSTGLGVAHITKLAAEKFLDGIEGKRVIIQGFGNLGSFTAKFLSEMGAK
IVGVSDSKGGVIDYNGLDFNKLMEVKKTTGSVINYPEGKKVTNDELLISECDILIPGALE
NVINKFNAPKVKAKLIVEGANGPLTADADEIMKQRGIPVVPDILANSGGVVGSYVEWANN
KMGEIIEEEEAKKLILNRMEKAFSEMYSKYNKLGDQDLRTSAMVVAVERVVNAMKARGLI
Download sequence
Identical sequences F4B694
gi|332796180|ref|YP_004457680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]